Conserved Protein Domain Family
Sec2p

?
pfam06428: Sec2p 
GDP/GTP exchange factor Sec2p
In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion.
Statistics
?
PSSM-Id: 368902
View PSSM: pfam06428
Aligned: 44 rows
Threshold Bit Score: 85.699
Threshold Setting Gi: 595455544
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003052826 177 KIAEERQKRLDTEKDKKKIEQELENLTAALFEEANKMVIAAKeeakADHEVLQRKNDQLKAQLADSESLLKSQQEQLSEL 256 [Nectria] haema...
Q6FNX8        80 QLEEEKSKRLAAEKEVDKLGQEVEDLTASLFDEANNMVSDAR----REKHDIEIQNSRLQETLKEKDTVLETLNLQLKNL 155 [Candida] glabrata
CAR23876      79 ELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADAR----RETHSVQVKNSKLAEQLQEKETLLETLEIQLKNL 154 Lachancea therm...
XP_003680720  80 ELVKEKTLRTTAERNVDDLNKEIEDLTASLFDEANKMVATAR----KESYTIEIKNNKLKEQLDEKDMILETLNLQLKNL 155 Torulaspora del...
CDF91781      82 ELRKEREAKAAAEANVDKLNREVEDLTASLFDEANNMVADAR----KASHALEIKNAKLVEQLQERDTLLETLNLQLRHL 157 Zygosaccharomyc...
P17065        79 DIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADAR----KEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNL 154 Saccharomyces c...
Q6CUU0        72 KFKKQEEICADAEKKVATLNQEIEDLTASLFDEANNMVADAR----KEQNAVEILNSKLKEQLKEKDLLLDTLSMQLKNL 147 Kluyveromyces l...
Q752A5        88 ELEEARKARLAAELAVERLNKEIEDLTTSLFDEANRMVSKAR----KEKHVVEQHNARLQEQLREKDMLLDTLTIQLKNL 163 Eremothecium go...
CCH58336      82 ELVKERQLREKAEGECTALNKEVEDLTASLFDEANHMVADAR----KEKAAVELRNTKLMEQLKEKDTVLETLELQLKNL 157 Tetrapisispora ...
EDO19099      80 ESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADAR----RGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNL 155 Vanderwaltozyma...
XP_003052826 257 KHVMEHMAAERDDQTN 272 [Nectria] haematococca mpVI 77-13-4
Q6FNX8       156 KKVLQTVDSESSINAn 171 [Candida] glabrata
CAR23876     155 KKVLYNLEEESNDRLK 170 Lachancea thermotolerans CBS 6340
XP_003680720 156 KKVIQNLEKESTTHSg 171 Torulaspora delbrueckii
CDF91781     158 KKVIQNLDDNSAASEq 173 Zygosaccharomyces bailii CLIB 213
P17065       155 KKVMHSLDNESTVTNN 170 Saccharomyces cerevisiae S288C
Q6CUU0       148 KNVLYKFENDFNSSKN 163 Kluyveromyces lactis
Q752A5       164 KDVLYKVEDEQNTRSR 179 Eremothecium gossypii
CCH58336     158 KKVLQEFQDEDSNNKR 173 Tetrapisispora blattae CBS 6284
EDO19099     156 KNVLHDLQNDPANIAV 171 Vanderwaltozyma polyspora DSM 70294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap