4H7O


Conserved Protein Domain Family
SATase_N

?
pfam06426: SATase_N 
Click on image for an interactive view with Cn3D
Serine acetyltransferase, N-terminal
The N-terminal domain of serine acetyltransferase has a sequence that is conserved in plants and bacteria.
Statistics
?
PSSM-Id: 399436
View PSSM: pfam06426
Aligned: 140 rows
Threshold Bit Score: 74.7995
Threshold Setting Gi: 123252561
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4H7O_A             10 WQTIVAEAREQAEQEPMLASFYHATIIKHDSLKAALSYILANRLNT-ASMPAMAVREVIEEAFA-ADPSISEAAACDICA 87  Vibrio cho...
jgi:Amuc_0527      36 WEWVEECARSAAAEEPAMRGILDDVCLSRNSLATSISARLARKLSR-RDMPRELIEPLIREALT-EDQNILSQIAQDLIA 113 Akkermansi...
vbi:Arad_3906      20 WDVIRHEAIDLAGREPTLRPLLTTQIVATRSDAESLANVLVARLST-AGIETRDLFALFQDVLT-RHPEILPATEADLVA 97  Agrobacter...
Q2K454             24 WAVIRAEANDLATREPILRQLLAEQVTDTAGSHEILARVLAARLSV-AQVETGDLFDLILSTL---DDDIMRKVEADLAA 99  Rhizobium ...
WP_012318413       33 WAALRAEAEAALIEEPLYAGIIQATILDQRSLAQAFAYRLAHRLGD-GDLARLSMRDLCLSAFE-ADPQAGAHAVRDLVA 110 Methylobac...
XP_015631062       55 WDVLRAEAQDDADDEPLLRKFYHDLVLSRPSLESALASLLAAKLCIpGALPQDQLRDLLAGALA-AHPEAGRAARADLVA 133 Japanese rice
BAJ93017           52 WEELYGEAQADAEDEPLLGMLYYELVLSHPSLEAALAAHLSAKLCIqGALPQDALRDILVGALA-AHPEAIRHTRADLLA 130 domesticat...
XP_002287732        4 WAQIRLEAKHALFHEPDAGPQLYQNVLRQPSLIDALASIICHEIET-ELIPATALKTLILDQLNlEDD---INLHLDVIA 79  Thalassios...
mgcchina:PST_3026  43 WSELRAQAQRALDTEPTLATIVRQTILDQPDFGGALAHRIGHALAD-SIEQSHTLTDRFAGLHH-QLPALAETACCDLQA 120 Pseudomona...
Q89EC9             13 WQRVRGEAQRAADADPVFGKALAGTILAHDDFAAALSDLIGRRLGG-SAAERARFSAFSFDAFR-GSPDLIEVAGRDLQA 90  Bradyrhizo...
4H7O_A             88 TVNRDPAVSM-YSMPLLYLKGYHAL 111 Vibrio cholerae O1 biovar El Tor str. N16961
jgi:Amuc_0527     114 IVDRDPACRT-PLEPLLFYKGFHAI 137 Akkermansia muciniphila ATCC BAA-835
vbi:Arad_3906      98 VRTRDPACTT-YLHALLNLKGFHAL 121 Agrobacterium radiobacter K84
Q2K454            100 VRERDPACTT-FLHALLNLKGFHAL 123 Rhizobium etli CFN 42
WP_012318413      111 IRERDPTCRR-YLDPFLFYKGLAAL 134 Methylobacterium
XP_015631062      134 ARDRDPACAK-MVHCFLYYKGFLAL 157 Japanese rice
BAJ93017          131 ARDRDPACAK-MVHCFLYYKGFLAL 154 domesticated barley
XP_002287732       80 SANRNPSSGRtALTAVLFHQGLHAL 104 Thalassiosira pseudonana CCMP1335
mgcchina:PST_3026 121 IVSRDPAFDS-ALEVFLFSKGFLAL 144 Pseudomonas stutzeri A1501
Q89EC9             91 IAIHDPAIAD-LLPPLLHFKGYVAL 114 Bradyrhizobium japonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap