2YWE


Conserved Protein Domain Family
LepA_C

?
pfam06421: LepA_C 
Click on image for an interactive view with Cn3D
GTP-binding protein LepA C-terminus
This family consists of the C-terminal region of several pro- and eukaryotic GTP-binding LepA proteins.
Statistics
?
PSSM-Id: 399432
Aligned: 268 rows
Threshold Bit Score: 87.4538
Threshold Setting Gi: 46396426
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YWE_A            492 INKKPVDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLRANVTAKCYGGDVTRKKKLLE 571  Aquifex a...
Q7VRQ8            490 INGQRVNALAVIVHRITAEFQGRILVNKLKSLILRQQFDIVIQAVIGKRVICRDVIKQLRKNVTHKCYGGDVTRKKKLLH 569  Candidatu...
Q89AM5            487 VNYKKIDSLSTIVHKTKILNQAKNVVEKMKNLIPRHQFDIIIQAVIGTKVIVRTTIKQLRKNVLAKCYGGDVTRKKKLLK 566  Buchnera ...
Q8D307            487 INKKLIDSLTKVINKNYINLYSKKTIENLKKIIPRQQFDIVIHIKINNKIISKGIVKQVRKNVLEKCYGGDVSRKKKLLK 566  Wiggleswo...
Q057R2            488 INFTKIDALSYICHKNDSQKIAKRIIEKIKKIIPRHQFHVPIQAAIENNIISRVNITQLRKNVLSKCYGGDISRKKKLLQ 567  Buchnera ...
eebua:ZICARI_136  484 LNKKKINNLSLFIHKKKIFIIGNQILDNLLKYFSKKMFNINLQISVNNKIISSKTIKSYRKNVISKCYGGDINRKNKLLK 563  Candidatu...
WP_013087711      497 INGKKIDCLSSMIHQKKSKKHAEKIIKIITESFPRQQFNVIIQAAIGKIIVSRSEIKPFRKNVLSRCHGGDSSRKMKLLG 576  Candidatu...
Q8I335            975 INKKKIDSLSFLAHKRNYEDKSRKLVSKLKTLINPHQFLIIIQAALESKIFVSEKIKPLKKNVTAKCYGGDITRRRKLIE 1054 Plasmodiu...
B3L3C9            784 VNNRSIDSLSFLAHKLNYQEKGKRIVLKLKEMIKPHQFLVVIQAGIGTRIFASERINPLRKNVTAKCYGGDITRRRKLLE 863  Plasmodiu...
A7AQ93            596 INGEEAGGLSMLVARDNAYKSGRLLVETLREVIPPKQFKINLQAAIGKRVIAALSIPALRKNVTERCSGGDPSRKRKLLE 675  Babesia b...
2YWE_A            572 NQKEGKKRMKQFGKVQLPQEAFLSVLK 598  Aquifex aeolicus VF5
Q7VRQ8            570 NQKIGKKRMKQVGKVNLPNSVFMSILN 596  Candidatus Blochmannia floridanus
Q89AM5            567 KQKIGKKRMKQIGNITIPQEVFLKILN 593  Buchnera aphidicola str. Bp (Baizongia pistaciae)
Q8D307            567 KQKIGKKRMKKIGNFFLPQDSLFSILN 593  Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
Q057R2            568 KQKKGKKRMKIIGNIKIPQEVFFTILK 594  Buchnera aphidicola BCc
eebua:ZICARI_136  564 KQKRGKMKLKKYNNFKINKNIIINFLK 590  Candidatus Zinderia insecticola CARI
WP_013087711      577 KQKKGKKKMKKFARWTLSRSILLSlkk 603  Candidatus Riesia pediculicola
Q8I335           1055 KQNEGKKKMFEIGKVKLPPNIFTKLFD 1081 Plasmodium falciparum 3D7
B3L3C9            864 KQSAGKKKMFSIGKVKLPPNMFTKLFd 890  Plasmodium knowlesi strain H
A7AQ93            676 NQAKGKKYMAEIGNVSIPFDAYKAVHk 702  Babesia bovis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap