Conserved Protein Domain Family
NPIP

?
pfam06409: NPIP 
Nuclear pore complex interacting protein (NPIP)
This family consists of a series of primate specific nuclear pore complex interacting protein (NPIP) sequences. The function of this family is unknown but is well conserved from African apes to humans.
Statistics
?
PSSM-Id: 399422
Aligned: 2 rows
Threshold Bit Score: 483.423
Threshold Setting Gi: 1622911675
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
F8WFD2        27 ADHRHRGTDFGGSPWLLIITVFLRSYKFAISLCTSYLCVSFLKTIFPSQNGHDGSTDVQQRARRSNRRRQEGIKIVLEDI 106 human
XP_028696518  28 PDHFQPGPDFFGIPWIAIIIVFLGISTLGIFLWKTSFGVSFLKTVLKLQNVHDRSTDVQRRAWRSNSRSQEGIKIGLEDL 107 Rhesus monkey
F8WFD2       107 FTLWRQVETKVRAKIckMKVTTKVNRHDKINGKRKTAKEhlRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQ 186 human
XP_028696518 108 FTSWRYMEAKVRAEV--HKVTTKVNSHYQIHGQRKTTEE--GKLRMKECEQAEKERQLSDAEENGKLVMKKIRTYKKMFQ 183 Rhesus monkey
F8WFD2       187 RAQALRRRAEDYYRCKITPSARKPLCNRVRMAAAehrhssgLPYWPYLTAETLKNRMGHQPPPPTQQHSIIDNSLSLKTP 266 human
XP_028696518 184 DMQQLQWRTEDSYRCKITPYARKALDNWVSLFVF-------LAFGHSLPGQDVDVFFSPQVCAQALQREMAERKAAYKQH 256 Rhesus monkey
F8WFD2       267 PeclltPLPPSaLPSADDNLKT 288 human
XP_028696518 257 G-----PIPLG-NCVVQKHLHP 272 Rhesus monkey
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap