3AGA


Conserved Protein Domain Family
RCC_reductase

?
pfam06405: RCC_reductase 
Click on image for an interactive view with Cn3D
Red chlorophyll catabolite reductase (RCC reductase)
This family consists of several red chlorophyll catabolite reductase (RCC reductase) proteins. Red chlorophyll catabolite (RCC) reductase (RCCR) and pheophorbide (Pheide) a oxygenase (PaO) catalyze the key reaction of chlorophyll catabolism, porphyrin macrocycle cleavage of Pheide a to a primary fluorescent catabolite (pFCC).
Statistics
?
PSSM-Id: 399420
Aligned: 11 rows
Threshold Bit Score: 390.936
Threshold Setting Gi: 300140415
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3AGA_B              18 TRKQLMVDLMSTVENRLQSQLLPCNLPPDVRNFNN--PNGSAEASLHIRSGDKS-SPIDFVIGSWIHCKIP--TGVSLNI 92  thale cress
XP_004234668        58 PHRELMVELVSTVENRLGESLLPCTLPSHVQYFEN--ESATAHASLYVRSGNSS-SQVDFILGSWVHCNLP--TGGALNI 132 tomato
XP_002277744        67 PHRDLMVELVSAVEARLDSYLLPCTLPPDVQYYEN--QSGTAQATLHVRSGHDS-SPIDFVLGSWIHCQLP--SGGALNI 141 wine grape
KRH14207            66 AQKNLMVDLVSTLENRFHTQLLPCTLPSDVQYYQS--QTATAQASLHIRAAHND-SPIDFVLGSWVHSELP--TGGSLDI 140 soybean
XP_002523576        57 PQRELMVDLLSAVENRLGSQLLPCTLPPDVQYCRN--QSGNAQAAFHIRSANQN-SPVDFILGSWLHCKLP--TGAALNI 131 castor bean
WGS:AAAA:OsI_33409  27 AHREVMLAVAGEAEARLGARLLPSEVPADVAWFGN--AAGDAVGSVDVRRGAPG-SSIAFMLEAWFHRELPggGGGAIDI 103 long-grai...
ERM93473            44 sgeKLMEGLLSTVESRLGPYLNPSFTPSDVRSFRN--QNGSSQGSVNIRGGNNTrTMIDFILGSWIHCKMP---HGILNI 118 Amborella...
EFJ07138            18 AKNKLMTSLATRLDRELGSLLNPTLTPPEVRSFQS--QDGVSQGSVVLRSGKQG-SKICFLLGSWLHSSLP---FGPLNI 91  Selaginel...
XP_009419351        75 sHRDLMLDLRSVVEDRLGPHLLPSAVPPDVLSFHS--PSGASRGALDIRSGGRD-SPVDFILESWLHCELP---TGALNI 148 wild Mala...
XP_020160585        56 AHREVAQALAAEAAAAVP--LLPSAVPADVADFRN--SAGTAVGTLDLRRGAPA-SSIDFMLHSSLHCKVP---NGAIDI 127 Aegilops ...
XP_002464982        58 AHREVMLELAHQMEARLGPWLLPSEVPADVACFGDaaVPGAALGSVDVHRGAPG-SSIDFMLEAWFHRALP--TGGAIDI 134 sorghum
3AGA_B              93 TSISGFLNSSTKAPNFVVELIQSSSKSLVLILDLPHRKDLVLNPDYLKEYYQDTALD--SHRQSLLKLPEVNPYVSPSLF 170 thale cress
XP_004234668       133 TSLSVYLRPSTDAPNFLIEVIQSSPTTLILILDLPPRKDLVQHPDYLKTFYEETQLD--KQRQLLEKLPEVKPYFSSSLY 210 tomato
XP_002277744       142 TSLSTYLNPSTDAPNFLIELIRSSPTSLVLILDLPPRKDLALHPDYLQTFYEDTKLE--SRRQLLEKIPESQPYFSSSLY 219 wine grape
KRH14207           141 TSLSAYLNSSTDAPNFVFEMIRSSPTMLLLILDLPPRKDLVLWPDDLKTFYEDTQLD--KHRQTLERVPEVQPYFSSSLY 218 soybean
XP_002523576       132 TSLSAYLNLSTDAPNFLIELIQSSPTSLVLIIDLPPRKDLVLYPDYLQTFYENSQLE--AHRQTLQKLKEVQPYVTSSLY 209 castor bean
WGS:AAAA:OsI_33409 104 TALIVNLNGATDAPHLVMEFIQGGPASLIVLLDLLPRVDLPLHPSYIHRYYAATGLDarARRRVAGLVPQSRPYVSPSLL 183 long-grai...
ERM93473           119 FTLVGMLNTRTDTPHLLLEVIQTGPSSLVLVLDLLPRKDLVLHSDYLKHYYEDAGLD--PLRQQLEKKPFSKPYISSSLY 196 Amborella...
EFJ07138            92 TTLQTILDPEIDSPHLLVELIQTGYKSLVLCVDNMPRKDLVMDPEYLKRFYEDSKLD--ELRAKLVKLPQCEYYVSPSLF 169 Selaginel...
XP_009419351       149 TTLFAFLDAATDAPHLLMEFIQSSPSSLILFTDLLPRKDLVLHPDYLDEFYQQTNLD--KPRQELAKLPQVQPYCSSSLY 226 wild Mala...
XP_020160585       128 TSVLIFLNALTDAPHFLMEFIQGSPTSMVVILDLLPRKDLALHPEYLHKYYEHTCLD--KQREKIEELPQTRPYRSPSLF 205 Aegilops ...
XP_002464982       135 TSLVVFLNGTTDAPHFLMELIQGGPSSLVVLLDLFPRRDLPVHPDYIDKYYGATSVD--AHRINIEKIPQVRPYVSPSLL 212 sorghum
3AGA_B             171 VRSAFSPTASMLKIDAE----EEDKLEEILRDHVSPAAKEVLEVWLERCV--KEEEEkivVG-EEERMELERRDKSFRRK 243 thale cress
XP_004234668       211 IRALVSPSAILVSIETDp--sQAIRIDEIIQDHISPVAKVMLDTWLNLCA--CTERR---LT-DDESKDLAKRDQIIKNK 282 tomato
XP_002277744       220 IRCIVSPTAIMTRIETEa--gGVERMEEILQSHVGPVAMEVLGIWLDQCA--FGERE---VG-DSEISYLEKRDRLIRSK 291 wine grape
KRH14207           219 IRTVSSPTAIMVRVLTEn--gGVERMEEIIRDHLDPISKQVLGIWLDHCA--CAKRE---VG-EAERAYLKKRDGLIRNK 290 soybean
XP_002523576       210 LRSFLSPTAIMILVETEa--gESGRMEEIIKDQVGPVAKAVFGVWLDKCA--CGGRE---VE-EEEKAYLKKRDELVKKK 281 castor bean
WGS:AAAA:OsI_33409 184 VRSLWSPAAVVADVQCGegpgGAAALDGIVRGELAATAMDVLGVWLEHCAggGGGGE---ME-AAERERMVARDRKVAAA 259 long-grai...
ERM93473           197 IRSVVSPTAILFQINSDs----QMSMDEIVGGDVEPVVKQVVETWLRLCLe-GTGRE---LE-ESDRERILRRDNVIKTI 267 Amborella...
EFJ07138           170 VRVMASPTALLLKFAAE----GEEELDGVVEESITPCVEEAVSIWLHGFT--ELGRT---LTsEAQISSLRERDDMMRKN 240 Selaginel...
XP_009419351       227 IRSVLSPTAIAVCINCGe--dGQGMMEDIMRGRLDAICKEIVRIWLDTCA--SSSKQ---LG-ETERANLLRRDGLIKNK 298 wild Mala...
XP_020160585       206 VRSACSPTAVSVTIDCGq--gGEGTLEEIVCGHLASAVKEVLQIWLHSCA--RDTSE---ME-EAEREIMIKRDQAVRLK 277 Aegilops ...
XP_002464982       213 VRSLWSPTAVVVDIQCGeq-gKEAALEEIVRGQLAHSAAELLHVWLNKCA--GSVEE---ME-ETEKEILVARDKMISTT 285 sorghum
3AGA_B             244 SIEDDLDLQFPRMFGEEVSSRVVHAIKE 271 thale cress
XP_004234668       283 TIEIDLESSFPRLFGQQVANQVLGVLRE 310 tomato
XP_002277744       292 TIEIDLGSSLPRLFGPETAGRVLEAMRG 319 wine grape
KRH14207           291 TIEIDLGSSFPRLFGPEVANRVLEAIKE 318 soybean
XP_002523576       282 IIEIDLASNFPRMFGPELADRILGAIQK 309 castor bean
WGS:AAAA:OsI_33409 260 ELEVNLAANLPRMFDAGVADRVVAEIRK 287 long-grained rice
ERM93473           268 GIEVDLLSNMPRLFGPDVTARVVDAFRK 295 Amborella trichopoda
EFJ07138           241 SVEVDLGANMPRLFGQETTDRVIAAVik 268 Selaginella moellendorffii
XP_009419351       299 TIEIDLAANLPRMFSPDVANRVVGEIQK 326 wild Malaysian banana
XP_020160585       278 SIEVDLTANLPRMFGPDVSGHIIAEIRK 305 Aegilops tauschii subsp. tauschii
XP_002464982       286 SVKLNLSANLPKIFDKHVSDRVVAEIDK 313 sorghum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap