1JG5


Conserved Protein Domain Family
GFRP

?
pfam06399: GFRP 
GTP cyclohydrolase I feedback regulatory protein (GFRP)
Tetrahydrobiopterin, the cofactor required for hydroxylation of aromatic amino acids regulates its own synthesis in via feedback inhibition of GTP cyclohydrolase I. This mechanism is mediated by the regulatory subunit called GTP cyclohydrolase I feedback regulatory protein (GFRP).
Statistics
?
PSSM-Id: 399415
Aligned: 13 rows
Threshold Bit Score: 117.846
Threshold Setting Gi: 215492190
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JG5_A         2 YLLISTQIRMEVGPTMVGDEHSDPELMQQLGASKRRVLGNNFYEYYVNDPPRIVLDKLECRGFRVLSMTGVGQTLVWCLH 81 
EDO32067       3 YILISTRIRLELGPTQCGDEWSDPELMALLDAELVHQFGNNFKEYLSKHPPRVVLNKLGKIGYKVISSTGIGQTIVWTLF 82  starlet sea ane...
EEN52803       3 YLLISTQIRMECGPTIVGDVESDKDLMEYLGATLQQMLGNNFKEWRTPKSPRVVLDLLERRGWRVVGMTGIGQTCAWTLH 82  Florida lancelet
EEC01831       3 YLLVWSQVPGAA-PTYL-DGSQDPALLKELGGKVNKPVFSKRTLVKVDDTPCSVLNKLEVMGYKVLAVSGDTLGTVWTVH 80  black-legged tick
XP_002407324   3 YLLVWSQVRGQL-PTYL-DGSQDPALLKQLGAKVTKPLMVKRATVHTDDSPGSVLNKLEGMGYKVVAVSGNPLGTVWTVH 80  black-legged tick
3_pfamImport   2 YVLISTLIRLEIGPTIVGDEHSDVALMKELGATLHHRAGNPFKEWSVEDPPRIVLDKLEVLGYKLVGTTGIGQTAIWTLH 81 
XP_004010500   3 YLLISTQIRMEVGPTMVGDEYSDPELMQHLGASKRSVLGNNFSEYYVNDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLH 82  sheep
Q6NVA8         3 YVLISTQIRMETGPTIVGDEFSDTQLMAQLEADKRTVLGNNFSEYCVNEPPRVTLNKLEKLGYRVVSMTGVGQTLVWCLH 82  tropical clawed...
XP_002193075   3 YLLISTQIRLEAGPTMVGDEHSDPHLMSILGATKRTTLGNNFCEYYVNDAPRMVLDKLESLGYRVVSMTGVGQTLVWCLH 82  zebra finch
Q6PBT6         3 YILISTQIRLETGPTMVGDEYSDPSIMNYLGARKITVLGNNFSEYHVDEPPRLVLDKLDKIGYRVVSMTGVGQTLVWCLH 82  zebrafish
XP_003386516   4 YVLITTQIRLENGPTICGDELSDPVLMAKLDAQLVRDAGNPFQVYSSPHPPRVILNKLACEGFRVVSMAGIGQTCIWTLY 83  Amphimedon quee...
EFB24969       3 HPLSSTQIHTEVGPTPLGDGHSAPELMWYLGASKRSVLGNHFCEYFISDPPCMVLDKLECKGFHVLSKREVGWTLVWCLH 82  giant panda
PIC35261       3 YILISTQIRMECGPTMVGDGESDAKLMEKLEAKLMKQLGNEFQEYITKWSPRKVLNQLEKEGWQVVAMAGIGQTCAWTLY 82  Caenorhabditis ...
1JG5_A        82 K 82 
EDO32067      83 K 83  starlet sea anemone
EEN52803      83 K 83  Florida lancelet
EEC01831      81 K 81  black-legged tick
XP_002407324  81 K 81  black-legged tick
3_pfamImport  82 K 82 
XP_004010500  83 K 83  sheep
Q6NVA8        83 K 83  tropical clawed frog
XP_002193075  83 R 83  zebra finch
Q6PBT6        83 K 83  zebrafish
XP_003386516  84 L 84  Amphimedon queenslandica
EFB24969      83 K 83  giant panda
PIC35261      83 K 83  Caenorhabditis nigoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap