2BID


Conserved Protein Domain Family
BID

?
pfam06393: BID 
Click on image for an interactive view with Cn3D
BH3 interacting domain (BID)
BID is a member of the BCL-2 superfamily of proteins are key regulators of programmed cell death, hence this family is related to pfam00452. BID is a pro-apoptotic member of the Bcl-2 superfamily and as such posses the ability to target intracellular membranes and contains the BH3 death domain. The activity of BID is regulated by a Caspase 8-mediated cleavage event, exposing the BH3 domain and significantly changing the surface charge and hydrophobicity, which causes a change of cellular localization.
Statistics
?
PSSM-Id: 399411
Aligned: 13 rows
Threshold Bit Score: 237.262
Threshold Setting Gi: 524984944
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BID_A         9 NGSslrdECITNLLVFGFLQSCSDNSFRRELDALGHElpv------laPQWEGY-------DELQTDGNRSSH----SRL 71  human
XP_005040440   5 NGS----LQMEHALLFTFLDASSDCQFKDQLHSLHSPqi--------mSCQASDd------DELQTDGNRSGH----FQN 62  Collared flycat...
Q8JGM8         8 NGS----DHMERMLLFAFLAESSGCEFQEQLPSLQSQgvlc---svkdALCYDSd------GELQTDGNRSGH----LQN 70  chicken
ELK02625      81 NGArlqhEHITDLLVFGFLQNCCNSNFHKELKALGHDlpv------paYPREDYd------DELQTDGNRCSH----IVL 144 black flying fox
XP_012664777   8 GSGlrdeHLTGLLVYGFLQSCSNSGFQRELEELGHEPfvrthllvrthLHEELDe-----dELQTDGSRASRF----YAE 78  small-eared galago
Q4JHS0         7 NGSslqdERITNLLVFGFLQSCPHASFHKELEVLGHElpv------htSGS----------DELQTDGNRCSY----FME 66  pig
XP_008248351  16 SGPgprdEHITNLLVLGFLQSCCSCSFHEELQVLGRElls------eaELADSYdccsyddDELQTDGNHASF----LQM 85  rabbit
XP_010589079   7 NGSglqnERITNLLVFSFLKNCPSCHFHEELAELSYElpl------paHLREEY-------DELQTDGNRNSHfhfqSFQ 73  African savanna...
XP_005340634   7 NGSdlrnEYITNLLVLDFLQSFSDCKFHQELRTLGQElpv------rtYLEGERe------DELQTDGNRAS-----LFM 69  thirteen-lined ...
Q9JLT6         7 NGSglgaEHITNLLVFGFLRN-NDRDFHQELEVLGQElpv------qvYLEGDRe------DELQTDGSRASRs---FYH 70  Norway rat
XP_003461816   7 NGAgtrgELVTDLLVFGFLCSRDNSNFHSELKALGQElpg------rpEV--DHd------DELQTDGNRLSH----FHG 68  domestic guinea...
EHB13699       7 NGAgfrdESITNLLVYSFLHTRNNSNFHPELEALGQElpv------gvCLEADHd------DELQTDGNRGSRl---LYG 71  naked mole-rat
NP_001238867   7 NGSgpqdERITNLLVFGFLQNCSNYNFHEELELLGRElpv------paYLKEDYd------DELQTDGNRCSYf---LDG 71  dog
2BID_A        72 GRIEAdSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTML 151 human
XP_005040440  63 GELEL-PPTNEEVIRIIAAQLAEIGDQFDKEIQARVVRDLVQHFVNERLSREEITLHLSRAVNKLLTSIPSDMAQEKAML 141 Collared flycat...
Q8JGM8        71 GELVPdPEVNEAIVRTIAAQLAEIGDQLDKQIKAKVVNDLVQHFLNENLPREEITRCLSQAVEGLARAIPSDLEQEKAML 150 chicken
ELK02625     145 EREETeSENQEEIIQNIARQLAQIGDRMDSRIPPRVVNYLAMEFMNVDLSEEDRKDCLSAALEEVMKTYPKDMEREKTML 224 black flying fox
XP_012664777  79 RIEADsGSQEDVIQNFARRLAQIGDSMDRSIPPRLVNNLVQQFRNPSLSEENRRGHLAAALEQVMQTCPADLTEEKATLL 158 small-eared galago
Q4JHS0        67 DAAETdSESQEAVIRDIARHLARIGDRMEYGIRPGLVDSLAAQFRNQSLSEEDRRQGLAAVLQQLVHSYPADMGQEKTLL 146 pig
XP_008248351  86 GRAEAgSESQEEVIRNIARRLAQIGDRMDHHIQPELLNNLVVEFVN-DHSEEDRRRRLASAVEQAMETWPADMEREKATL 164 rabbit
XP_010589079  74 GRLEQdSGSQEEVIQSIAERLAQIGDEMESQVHPSLVQNLARQFMDRNLSEEDRRKHLATAVDRVMQTCLLDMELEKKKL 153 African savanna...
XP_005340634  70 GRIEAdSESQEEVIQNIARHLAQVGDEMDRSIQPELVNELVARFMNAGLSEEDRSNCLDTTLKAAMQTYPKDMENEKTML 149 thirteen-lined ...
Q9JLT6        71 GRIEPdSESQDEVIHNIARHLAQAGDELDHSIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTSFPRDMENDKAML 150 Norway rat
XP_003461816  69 GRREAdSESQEELIQHIASQLALIGDEMEHKIQASVVHQLSTQLRDSSLTPEGRRHCLAATLGEVMQTCPADVEQEKAVL 148 domestic guinea...
EHB13699      72 GRREGdSENQE-IIHSIAWHLAEIGDELDRSIQPGLVNQLAMHFRNPGLSEEGRRHYLAATVEEVMQTYATDMEQEKAKL 150 naked mole-rat
NP_001238867  72 GARd--SESQEEIIQDIARQLAQIGDRMDHSIHPGLVNNLAMQFMNVNLSEEDRRKHLAAALEQAMQTYPKDMEKEKTML 149 dog
2BID_A       152 VLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLA 192 human
XP_005040440 142 VLAMVLTKKIVNTMPSLLRRVYDATVNYMNQQFHDYIVEML 182 Collared flycatcher
Q8JGM8       151 VLAMLLTKKVANQMPSLLQRVFSTTVNYISQHFHNYIVRML 191 chicken
ELK02625     225 MLTMLLAKKVADHTPSLLRGVFHTTVNFINQNLLTYVRNLL 265 black flying fox
XP_012664777 159 LIMLLAKKVADHTPSLLPVVFRTTVNFINRNLLASVRNLAR 199 small-eared galago
Q4JHS0       147 VLTMLLARKVAEHSPALLRDVFHTTVNFINQNLLTYLRNLV 187 pig
XP_008248351 165 MLTMLLAKKLAEHTPSLLRAAFRAAVTLINQDLLAYVRNLA 205 rabbit
XP_010589079 154 MLTMLLAKKVADHMPSLLRDVFRTTVNFINQNLLTYVRNLA 194 African savanna elephant
XP_005340634 150 IMTMLLAKKVANHTPSLLHDVFRATVNFINQNLFTYVRDLV 190 thirteen-lined ground squirrel
Q9JLT6       151 IMTMLLAKKVASHAPSLLRDVFRTTVNFINQNLFSYVRDLV 191 Norway rat
XP_003461816 149 IMTMLLARKVADHTPRLFRVVYDTVVDFINQNLLTYVRDLV 189 domestic guinea pig
EHB13699     151 ITAMLLVRKVADHTPSLLRDIFHTTVNFINQNLLTYMRDLI 191 naked mole-rat
NP_001238867 150 MLAMLLAKKVADHTPSLLRDVFHTTVNFISQNLLTYVRNLV 190 dog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap