6NMI


Conserved Protein Domain Family
MAT1

?
pfam06391: MAT1 
CDK-activating kinase assembly factor MAT1
MAT1 is an assembly/targeting factor for cyclin-dependent kinase-activating kinase (CAK), which interacts with the transcription factor TFIIH. The domain found to the N-terminal side of this domain is a C3HC4 RING finger.
Statistics
?
PSSM-Id: 399410
Aligned: 53 rows
Threshold Bit Score: 181.672
Threshold Setting Gi: 74957435
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6NMI_H        53 LRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDF-PSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKD 131
XP_011275776  81 LRKAKFKAQIFDDIDVEREVDIRKRVSQIFNKSGDDF-TELDKYNAYLEEVETIIFNLVNKIDIEETEAKLSVYEEHNKS 159 Wickerhamomyces...
Q6CT73        60 LRRNKFKTQIFDDVGVEKEVDIRKRVFNVFNKTLEDFdNNQDDYDKYLEEVEDIIYNLDHGIDMEKTEERLRTYEELNKQ 139 Kluyveromyces l...
XP_002555255  62 LRKNKFKTQVFDDVNVEKEVDIRKRVFNVFNKTLDDFeGDLKAFNKYLEEVEDIVYNLDNGIDVANTEEKLRTYEDLNKQ 141 Lachancea therm...
XP_003646011  60 LRKNKFKTQIFDDVDVEKEVDIRKRVFNVFSKNLEDFdGDLDAFNKYLEEVEDIIYNLDNGVDVAKNEEKLRTYEELNKQ 139 Eremothecium cy...
CCC67351      61 LRKNKFKTQVFDDVAVEKEVDIRKRVFNVFNKTLDDFdNDLDKYNKYLEQVEDIIYNLDHGIDVVETEEKLRSYEELNKQ 140 Naumovozyma cas...
Q6FMP4        73 LRKNKFKTQIFDDVGVEKEVDIRKRVFNVFNKTLEDFdNDLEAYNKYLEEVEDIVYKLDNKIDVVETEEKLRTYEELNKQ 152 [Candida] glabr...
CCF59891      71 LRKNKFKTQIFDDVGVEKEVDIRKRVFNVFNKTLSDFgGNMDEYNIYLEEVEDIVFNLDHGIDVVKTEEKLRTYEELNKQ 150 Kazachstania af...
CCE65159      61 LRKNKFKTQVFDDVGVEKEVDIRKRVFNVFNKTLEDFdGNLDEFNKYLEEMEDIIYNLDHGIDVEDTEEKLHSYEELNRQ 140 Tetrapisispora ...
XP_003671525 104 LRKNKFKTQIFDDVGVEKEVDIRKRVFGVFNKDLNDFdGDLKKFNEYLEHVEEIVYKLDHGIDVEETERQLKDYEELNKQ 183 Naumovozyma dai...
6NMI_H       132 VIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDL----------------PVA 195
XP_011275776 160 KILENNNNREKEYEDFKKQEELDKELRLKKIMLEKQIEQEEKEMNEQAKREILNKLSTSQ-----------------DPN 222 Wickerhamomyces...
Q6CT73       140 LIMANLERSKQDVANFEQRQKFEKEMKLKKRLLEKQIEEEERANREWAKREIVNQLTVNE-----------------DAE 202 Kluyveromyces l...
XP_002555255 142 LIMANMKRSRQDLDNFEQRQKFEKEMKLKKRQLERQIEEEELANREWARKEIVNQLSTAD-----------------DAE 204 Lachancea therm...
XP_003646011 140 LIMANMERNKQFLENFEQRKKFEKEMKLKKRMLERQIEEEERANKEWAKREIVNQLSSNI-----------------DAD 202 Eremothecium cy...
CCC67351     141 LILNNIERNKKDLENFEQRNKFEKEMKLKKRMLERQIEEEDRSNKEWAKKEIINRLSQSN-----------------DAE 203 Naumovozyma cas...
Q6FMP4       153 LIMNNMERSKKDLENFEQRQQFEKEMRMKKRMLERQIESEDKMNKEWAKREIVNRLASST-----------------NAD 215 [Candida] glabr...
CCF59891     151 LILNNMERNKQDTENFAARQQFEKEMKLKKRLLEKQIEEEERFNKEWAKKEIVNRLTSSNSi---------------DTE 215 Kazachstania af...
CCE65159     141 LILNNIERNRQELQNFEQRQHFEKEMKMKKRMLEKQIDEEDKMNKEWARREIVNRLTTTA-----------------STE 203 Tetrapisispora ...
XP_003671525 184 LILSNIERNKKEFENFEEREKFQKEMRLKKRMLERQIEEEDKSNKEWAKREIINRLAAASTsgslssassastsivdNTQ 263 Naumovozyma dai...
6NMI_H       196 LLLAQHKDRSTQL-------EMQlekpkpvKPVTFSTGIKMGQhiS-LAPIHKl-EEALYEYQP 250
XP_011275776 223 QMINQIKSSTLKRssarrkqLNEiikslnsKGNPQEQQESNtvpftpfngdrvlvknfnpseey 286 Wickerhamomyces ciferrii
Q6CT73       203 EVIENVKKTVKLKkssarrkLEElnkvlrnNPYMTMTN---------GRMKKKd----TVPFTP 253 Kluyveromyces lactis NRRL Y-1140
XP_002555255 205 DVIAHVKKTVKLKkssarrkLEElnkvlknNPYMTVSN---------GLMKKKe----SVPFTP 255 Lachancea thermotolerans CBS 6340
XP_003646011 203 EVIENVRKTVKLKkssarrkLQElnkvlrnNPYMQMSN---------GTMKKQe----KVPFTP 253 Eremothecium cymbalariae DBVPG#...
CCC67351     204 EVIEGVKNTVKLKkssarrkLDElnrvlknNPYFASSNPNSNQ--NlMLLRKQkeMESSIPFTP 265 Naumovozyma castellii CBS 4309
Q6FMP4       216 DVIEGVKNTVKLKkssarrkLEEinrvlqnNPYSSLML-------SqGLSRKEd----NVPFTP 268 [Candida] glabrata CBS 138
CCF59891     216 DVIEGVKNTVKLKkssarrkLEElnrvlksNPYFSSNS---------NVSRKKd----MVPFTP 266 Kazachstania africana CBS 2517
CCE65159     204 DVIEGVKNTVKLKkssarrkLEEinrvlksNSYLASTV-------GlNASRIKk----SVPFTP 256 Tetrapisispora phaffii CBS 4417
XP_003671525 264 DVIESVKSTVKLKkssarrkLDElnrflqdNPYFSSSNPNSTQ--NtLLYQQQh-GGSVIPFTP 324 Naumovozyma dairenensis CBS 421
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap