Conserved Protein Domain Family
DUF1075

?
pfam06388: DUF1075 
Protein of unknown function (DUF1075)
This family consists of several eukaryotic proteins of unknown function.
Statistics
?
PSSM-Id: 399408
Aligned: 27 rows
Threshold Bit Score: 127.812
Threshold Setting Gi: 156550518
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003968046   5 RSISIGRFLGQRNREVAKTWSYRRMCNKPQESKVESPPstvs---ehppRASFKVP------G-YRPSEMDRKILLWSGR 74  torafugu
XP_015133924  61 LCCARGVRNRARGAQGAVLQTAAPGWSSHQGATWCPLQm----------RSLHQIPrpafkhE-RRPTNFDKKVLVWAGR 129 chicken
XP_006565202  14 KI--RQLHSTFVKNENKPVTETSKIKTETSKSTNVSQAeke------aiEFVSGES------L-YTLTNFDKRILVWVKR 78  honey bee
Q9CX19        14 GFTTHRAPQIISRWPRWGPRV---ACH-PCSSSGQNPSgfe------ppEKVHRIP------AqYKPSKFDKKILLWTGR 77  house mouse
XP_005596956  17 LHCAPGTPGDAVRWPFAALRSRGL----PRYSSDGAPCgsgp---qgpaGKVHRVP------AeHKPSQFDKKILLWTGR 83  horse
XP_003311499  17 VRCGPGAPLEATRRPAPALPPRGL----PCYSSGGAPSnsgp----qghGEIHRVP------TqRRPSQFDKKILLWTGR 82  chimpanzee
A6QPI4        17 PCCAPGAPPEVERRPVASLWPRGH----PQYSCGGSPGssep---pgsaEKVHRVP------AeHKPSQFDKRILLWTGR 83  cattle
XP_006628056  18 GHVRRAGPGAQSARRQ--------LCSKPQQSHSEPTAqsalpnsgeavQPGFKIP------G-YKLSDFDKKILLWAGR 82  spotted gar
A3KP48        17 GQWRRGMMTTGNRR----------LCIKPQEGPSASPQt---------qRPGFKLP------G-YRPSDWDKKMLMWSGR 70  zebrafish
XP_003439238  15 GQR-RHVIQTWSHRG---------MCNKLQATKAEASPaapa----hepRPAFRVP------G-YRPSDMDKKMLIWSGR 73  Nile tilapia
XP_003968046  75 YKTADQIPEFVSFEMIDAARNRIRVKACYVMMAATIGACLVMVILGKQAVSRNESLT 131 torafugu
XP_015133924 130 FKKEEDIPKYITSEVLDAARNTVRIKVCYIMIALTLLGCLAMVITGKEAAKKdhtll 186 chicken
XP_006565202  79 FPSMDKVPKQVSIRTIQLAHTKARIKVCFYMMAFAIIGSILAVMSGKRDVAAGKNLl 135 honey bee
Q9CX19        78 FKSIEDIPPLVPPEMIAVSRNKARVKACYIMIGLTIVACFAVIVSAKRAVERHESLT 134 house mouse
XP_005596956  84 FKAMEEIPPRVPPEMIDAARNRARVKACYIMIGFTIIACFAVIASAKRAVERHESLT 140 horse
XP_003311499  83 FKSMEEIPPRIPPEMIDTARNKARVKACYIMIGLTIIACFAVIVSAKRAVERHESLT 139 chimpanzee
A6QPI4        84 FKAMEDIPPRIPPEMIDAARNKARVKACYIMIGLTIIACFAVIASAKRAAERHESLT 140 cattle
XP_006628056  83 FKTKEQIPEIVSFEMIDGARNKVRVKACYAMIVLTVVGCLGMVILGKQAVGRHESLT 139 spotted gar
A3KP48        71 FKTVEQIPEFVSFEMIDAARNRVRVKACYIMMGLTIFACLVMIVSGKKAVSRKESLI 127 zebrafish
XP_003439238  74 FKSADQIPETVSFEMIDAARNKIRVKAAYVMMAATIGACMIMVFMGKRALARNETLT 130 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap