5LNK


Conserved Protein Domain Family
NDUF_C2

?
pfam06374: NDUF_C2 
NADH-ubiquinone oxidoreductase subunit b14.5b (NDUFC2)
This family consists of several NADH-ubiquinone oxidoreductase subunit b14.5b proteins (EC:1.6.5.3).
Statistics
?
PSSM-Id: 399399
Aligned: 17 rows
Threshold Bit Score: 148.992
Threshold Setting Gi: 568259183
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LNK_OO       11 LQFLPDEARSLPPPKLTDPRLAYIGFLGYCSGLIDNAIRRRPVLSaGLHRQFLYITSFVFVGYYLLKRQDYMYAVRDHDM 90 
Q02827        11 FQFLPDEARSLPPPKLTDPRLAFVGFLGYCSGLIDNAIRRRPVLLaGLHRQLLYITSFVFVGYYLLKRQDYMYAVRDHDM 90  cattle
EFN66709      19 LELLKPDPNYKASILQDYAVEIICVGSGFGTACLKNFLGRKPYYA-GIHLHIVSMAIGYVASQAIKKYIDTYKAERDSKL 97  Florida carpent...
EFA02843      12 LEVLSNDETRIPSFMSKYWAPGIGGGSAFIAMLITNWFLKKPILS-GIQAHVLVTAGGAALGKYIDDYRNNYFAERDAAF 90  red flour beetle
XP_002021478  10 LELLTNKGNRQASFLSPIWNPFACTLAGFGLAIFVNWGFRKPVMS-GIQKHIAFAAIGGGAGYYFDQKRNEYLAKRDAVL 88  Drosophila pers...
XP_002052927  10 LEILTNKGNRQPTFVSPIWNPIAGAIAGFGIALFVNWGFRKPAFS-GIQNHIAFTAIGAGLGAFIDKQRDAYLAKRDAVL 88  Drosophila virilis
XP_002003559  10 LEILTNKGTRQPTFLSPIWNPMAGALAGFGAALFTNWGFRKPILS-GIQKHILFTIIGGGVGYYLDNKRNEYLAKRDAVL 88  Drosophila moja...
1_pfamImport   1 LELLENKNNRIPSFLSDKYNPVGCGLLGVGAATFINWALRRPLLS-GVQKHIILGVGGVLLGSWLEEKRVAHFAEKDAVL 79 
ETN67162       8 LELLS--GTTSKTWLDDKWAPGVGGLFGFLGACYVNYGTGRPLLS-GIQKHVAAAIAVGTLATMANKWRDSYLAEKDATL 84  Anopheles darlingi
Q0MQF9        10 LRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPVATaGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREM 89  chimpanzee
5LNK_OO       91 FSYIKSHPEDFPEKDKKTYREVFEEFHPVR 120
Q02827        91 FSYIKSHPEDFPEKDKKTYGEVFEEFHPVR 120 cattle
EFN66709      98 RDYIIRHPELFPEPVRVKYSEILDEWHPIR 127 Florida carpenter ant
EFA02843      91 RHYIQLHPEDFPDFTRKKYSEVLEPWIPIR 120 red flour beetle
XP_002021478  89 RHYIELHPEDFPVKDRKKYADVLESWVPVR 118 Drosophila persimilis
XP_002052927  89 RHYVELHPDDFPKTDRKKYGEVLESWVPVR 118 Drosophila virilis
XP_002003559  89 RHYVELHPEDFPKTNRKKYADVLESWVPVR 118 Drosophila mojavensis
1_pfamImport  80 RHYVQLHPDDFPVKPRVKFADVLESWTPIR 109
ETN67162      85 RHYIELHPEDFPTPERKKFADLLEYWQPIR 114 Anopheles darlingi
Q0MQF9        90 FGYMKLHPEDFPEEDKKTYGEIFEKFHPIR 119 chimpanzee
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap