Conserved Protein Domain Family
DUF1062

?
pfam06353: DUF1062 
Protein of unknown function (DUF1062)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399390
Aligned: 29 rows
Threshold Bit Score: 169.322
Threshold Setting Gi: 506240141
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCY48387          37 MNAQKRNIDVWLIYRCTKCDNTCNLTILSRSKPDLIDKALFHGFSMNDRNTAWRYAFSTELERKNNIKLDySSVGYEVIS 116 Bacteroides...
CCH30791          60 VNANGKLLDVWLLVGCESCGRTSKIPVHERVHVNALDHDRLVLFENNDPATVRDLTTDPAAAGRAGYRLD-WRGTWVLDT 138 Saccharothr...
jgi:Caci_8866     37 VNANHKLLDVWLLALCAQCGETIKLTVLERAHVRSIDPAALDGFHENDASLAARLLTEPRLTQRNGIALD-WADGWRLDM 115 Catenulispo...
WP_013021283      35 VNANQKLIDVWLLALCTGCGETTKLTVLERTRVRAIPSGLLDRLLHDDPDLIAELLQDPAIQRRNRVCLD-WEDAWRLDT 113 Stackebrand...
jgi:Caci_6303     42 VNANHKLLDVWLLALCIGCGETTKLTVMERTNVRAIKPEVLRRLHDNDTTLAAELLQDPGVRHRNRVALD-WGDAWRLDT 120 Catenulispo...
AORICAS:Z0002599  35 VNANHKLIDVWLLVLCTGCEDTAKLTILERVNVRSVRPDLLERLHENDLGLAAELLQDPAVLRRNHVSLD-WEGAWRLDT 113 Amycolatops...
O54178            35 VNANHKLLDAWLLVLCTACGDTAKLTVLERMNVRSVRPGLLDRLHANDPGLAAELLQDPIVQRRNRIALD-WADAWRLDT 113 Streptomyce...
WP_009291247      42 VNAQRKYLDVWLIYKCFGCEATWNLTVLSRIHPKAVSRELLDKFHGNDQILAHKYAMNTDLLKRNGCKI--GPYDYKITG 119 Anaerostipe...
WP_013378644      37 VNAQRKYLDIWLIYKCAKCDTTWNAAVYSRVSPQALNANLLEGFYSNEEGLARQYAMDFQFLKGNGADV--LRPSCSVLG 114 Clostridiales
Q180G8            37 VNAQHKYLDIWLIYKCSNCDSTWNSTIYSRVNPKSLNPEILEQFHTNDYNLVKQYAMNMELLHRNGAEV--GIPEYKIVG 114 Clostridioi...
CCY48387         117 NISEKDIAntmEETLKIQIKCDFEFNLRLSSFLRDYFSLSANQLKRIFEQEIISVSDNK 175 Bacteroides sp. CAG:189
CCH30791         139 DLPFHEPDhgePVPLEVVVRFELPAPVRVEKLLMAGFGLSRSAVRGLVGSGRIRLPVAV 197 Saccharothrix espanaensis DSM 44229
jgi:Caci_8866    116 DPVDLPK----ADILDVSVEFTHHIPLRVTTVIATGLEMSGSEVAKHIASGVISSDDKl 170 Catenulispora acidiphila DSM 44928
WP_013021283     114 GEPDRQG----AEVIEVAVHFAARIPVRVERLIAEGLGLSRAEVERLTVTGNLVSAVKP 168 Stackebrandtia nassauensis
jgi:Caci_6303    121 GAPGHVS----HEGRDVTVRFAAQIPVRPVKLIAEGCGLSRSEVDRLIADGKVVSTAKL 175 Catenulispora acidiphila DSM 44928
AORICAS:Z0002599 114 GSLCH------GDFRDVSVRFEARIPLRPVRLIAEGCGLSRGEVERLIEEGKVVSAVRl 166 Amycolatopsis keratiniphila
O54178           114 GGPDHPD----REVIDVSVRFAARIPVRPVRLIAEGCGLARAEAERLIAEGRLVSAVRL 168 Streptomyces coelicolor
WP_009291247     120 CAAF-------DGPVRLHIRSNDASDVKVSAILREKLQLSRKEFEDMLSDGRIQSESEN 171 Anaerostipes caccae
WP_013378644     115 DIPAS------GEVSEVEIQSEYPFPVKVSTLVRDKLCLSQKDYLERVTEGKIRSSAGQ 167 Clostridiales
Q180G8           115 QEINI------NDLTQVHIISKYPCQLKVSTLLREKLGLSRKVFDEMLDCGIIRSNSGV 167 Clostridioides difficile 630
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap