Conserved Protein Domain Family
HSL_N

?
pfam06350: HSL_N 
Hormone-sensitive lipase (HSL) N-terminus
This family consists of several mammalian hormone-sensitive lipase (HSL) proteins (EC:3.1.1.-). Hormone-sensitive lipase, a key enzyme in fatty acid mobilisation, overall energy homeostasis, and possibly steroidogenesis, is acutely controlled through reversible phosphorylation by catecholamines and insulin.
Statistics
?
PSSM-Id: 399389
Aligned: 27 rows
Threshold Bit Score: 343.849
Threshold Setting Gi: 765551234
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5R272        52 GTLYAACQDHAAFFARDHTELGQ-----RLHAAHIAWQDFIVLANRLVQQIAAFAHEYDFDEQTPGNGYRSFIYVTNAC- 125 Drosophila sech...
P16386         8 QSLVTLAEDNMAFFSS---QGPGet-arRLTGVFAGIREQALGLEPALGRLLSVAHLFDLDTETPANGYRSLVHTARCC- 82  cattle
XP_014345780  39 QVLHTLAEDNITFFRENSSet-----grRFMAAFAKIQEHARSLEPIVHCFSRIYHIFDFDAQTPANGYRSLMKVVRSC- 112 coelacanth
XP_023200721  14 TALDKVCEENICVLSGPSESPYGtv-tkRLVACMRKIRQHGRALEPVVASFTAVYHHYDFDAQTPANGYRTLVKVLQSC- 91  southern platyfish
XP_011607633   8 TTLDTVCEDIISNMCAPSDMPYGav-atRLVTCMKEIQEHGRVLKPVVAGFISVFHHYDFDAQTPGNGYRTLVKVLQSC- 85  torafugu
XP_003447301  14 ATLEKVCQDNISVFCGPSRLPHGta-veRLVTCVKQIQEHGRALEPIVTSFTAVYHHYDFDAQTPGNGYRTLVKVLEAC- 91  Nile tilapia
XP_005159552   8 AGLQTICLDVISTLNGSSSNSSNadaaeRLLGVMKQIQEHGRAVEPLITGFMTVYHHFDLDEQTPGNGYRTLVKVVHSC- 86  zebrafish
4_pfamImport   3 AALYSVCEENAAFFSGGSKGSPGda-aqRLVDTMVLIQGHAHNLEPVVSGFAAVYHHFDFDPHIPANGYRSLVKV--SCq 79 
XP_002610124  52 KTLRSLTANNSEYFERHKTQYSS-----RFSSAVCILQGHADAIQPILEGFIRIAPDFDVDESTPGNGYRSLVKVVGTC- 125 Florida lancelet
XP_007258339   8 STLDSVCVEMISAISSQVSLLSNna-tsQLLSAIGRIQEHSHAVEALVAGFTAVYHHYDFNAETPGNGYRTLVKVVLSC- 85  Mexican tetra
Q5R272       126 IAHGIS------ICQQLTATRSTIFFRKKFYMKEVEACSQLLSSLCTCLQYLLILRQWSaSTGDLFACGN-HTAEQLFEL 198 Drosophila sech...
P16386        83 LAHLLH------KSRYVASNRRSIFFRTSHNLAELEAYLAALTQLRALAYYAQRLLTTN-QPGRLFFEGDeRVIADFLRE 155 cattle
XP_014345780 113 VLYIIH------KSRYVAANRRSIFFRASHNCAEIEAYCTALTQLRALVYFAQRLLTAN-RHGNLFFEEDrGLSEEFVKE 185 coelacanth
XP_023200721  92 LVHIIH------KGRYIASNCRGAFFRAEHNAAEMEAYCSALCQLRALLHLAQRLIHDN-AHGHLYSPQDaDLSDRFVQE 164 southern platyfish
XP_011607633  86 LFHIIH------KGRYIASNCNSAFFRAEHNASEMEAYCNALCQLRALLHLAQQLLNDN-VRGELYSLPHtDLSRQFVQE 158 torafugu
XP_003447301  92 LLHIIH------KARYIASSYSNPFFRVDHNTSEMEAYCSALCQLRALLHLAQQLINDN-DCGQLYSLQDeDLSRSFVQE 164 Nile tilapia
XP_005159552  87 IIHITH------KARYIASNCTGAFFRMDHNVAEMEAYCSALCQLRALLYLAQVLLNDN-PNGQLYSQEEgGLSERFVQE 159 zebrafish
4_pfamImport  80 AVHLFHrlilccKSGWIN-------FSSCGISTPAEPSVLSLLQLLMKHHDLQWLQCSR-AANPLESRGLaGVLLLYFRM 151
XP_002610124 126 IRRIIH------VQRKVVNNRDGLLFQSKHYCQELEAYASVLCQLRAIMDVAQKVLAKS-KHGQLFPEEK-LFPEFLFEE 197 Florida lancelet
XP_007258339  86 LLHIIQ------KARYIASNCGGVFFRVDHNASEMEAYCTALCQLRALLYVAQRLLNDN-EHGQLYSQEE-GLSEKFMKE 157 Mexican tetra
Q5R272       199 GDTINQYCFYGRCLGFQYGDSIRGVLRFLGISMASYSESYYSQedDGPIVKTTRSLWTSGKYLMNPELRARRIVNISQNA 278 Drosophila sech...
P16386       156 YVTLHKGCFYGRCLGFQFTPAIRPFLQTISIGLVSFGEHYKRN--ETGISVTASSLFTDGRFAIDPELRGAEFERIIQNL 233 cattle
XP_014345780 186 YTTMHKGCFYGRCLGFQFTPAIRPFLQTISIGLVSFGENYRRH--ESGIGVAASSFFTSGKYAIDPELRGAEFERITQNL 263 coelacanth
XP_023200721 165 YSSMHKACFYGRCLGFQFSPALRPFLQTIVISMVSYGETYGRQ--QSGIGTAALSLLTSGKYVINPELRGAEFERITQNL 242 southern platyfish
XP_011607633 159 YSSMHKACFYGRCLGFQFSPALRPLLQTVVISMVSYGEMYGKQ--QPGLGMAALSLLTSAKYVIDPELRGAEFERITQNL 236 torafugu
XP_003447301 165 YSSMHKACFYGRCLGFQYSPSIRPFLQTVVISMVSYGETYGKQ--QSGFGTAALSLLTSGKYVIDPELRGAEFERITQNL 242 Nile tilapia
XP_005159552 160 YISMHKACFYGRCLGFQFSPSLRPFLQTVVISMVSFGENYKKQ--QTGLGIAALSFFTSGKYVVDPELRGAEFERITQNL 237 zebrafish
4_pfamImport 152 FENKHTVMYRGKHHGFTSCRAIKTMMNCFGFSICTVGVQHQCV--KIKLRVAASSIFTSGKYAIDPELRGAEFERITQNL 229
XP_002610124 198 AESLDKECFYGRCVGFQFCSSMQPIFHTISTAMASFAEAYSDH--DGQLTRALASLLNSGKYAMNPELRARTIVGMCDKA 275 Florida lancelet
XP_007258339 158 YTSMHKACFYGRCLGFQFSPSLRPFLqtvvisMVSFGenykk--qqtriGRAALSVFTSGKYVVDPELRGAEFERITQNL 235 Mexican tetra
Q5R272       279 KIDFCKSFWFLAESEMMHKLPSIVGSSIKVNRLIELPAEPLKLPRrkdfkasenlssdvnqnqgDGDFVEIPVPTAHLGP 358 Drosophila sech...
P16386       234 DVHFWKAFWNITEIQVLSSLANMASTTVRVSRLLSLPPVAFEMPLts----------------dPELTVTISPPLAHTGP 297 cattle
XP_014345780 264 DVHFWKAFWNITEMEVLTSLVNITSSTVRVNKVLSVPPNSFDLPLat----------------dPNLMVTITPPVAHTGP 327 coelacanth
XP_023200721 243 DLHFWKSFWNVTESDILSGFTRIASNPVQVNLTLTVPPESLRLPLas----------------dPRLSTSVSPPVAHWGP 306 southern platyfish
XP_011607633 237 DMHFWKSFWNLTESGLLTGFSRMASSPVQVNVTLTLPPVTLHVPLaa----------------dPRLTTTVSPPVAHWGP 300 torafugu
XP_003447301 243 DMQFWKSFWNLTESGLLSGFNRIASKQVQVNFTMTVPPVTLRLPLas----------------dPRLSVTVSPPIAHWGP 306 Nile tilapia
XP_005159552 238 DMQFWKTFWNITETELLSGLTRITSSVVQVNVTLTVPAESLSLPLas----------------dPSLSVAVKPPVAHWGP 301 zebrafish
4_pfamImport 230 DVHFWKSFWNITETEVLSGLASMTSTQVKVNRALSVPPLSFDLPLma----------------dDTASVTIAPPSAHVGT 293
XP_002610124 276 DISFCKAFWNITEEGPLQHMSGFLSSSVNVNKVFHIPAMPFEMESsl----------------eDGELVTITPPCSQTGP 339 Florida lancelet
XP_007258339 236 DMQFWKTFWNITETELISSLASITSNTVQVNLMLSVPGEPLSLPLas----------------dPSLVVNVSPPVAHWGP 299 Mexican tetra
Q5R272       359 GlPVSVRLLSAKRRAGML 376 Drosophila sechellia
P16386       298 G-PVLVRLISYDLREGQD 314 cattle
XP_014345780 328 A-PVQMRLLSYELREGQD 344 coelacanth
XP_023200721 307 G-PVHMRLISYDLRDGQD 323 southern platyfish
XP_011607633 301 G-PVHVRLISCELREGQD 317 torafugu
XP_003447301 307 G-PVHMRLISYELREGQD 323 Nile tilapia
XP_005159552 302 G-PVNVRLISHVLRQGQD 318 zebrafish
4_pfamImport 294 A-PVQMRLISYDMRDGQD 310
XP_002610124 340 G-PVQVRLICFENREGQp 356 Florida lancelet
XP_007258339 300 G-PVNVRLISHALREGQD 316 Mexican tetra
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap