Conserved Protein Domain Family
ComK

?
pfam06338: ComK 
ComK protein
This family consists of several bacterial ComK proteins. The ComK protein of Bacillus subtilis positively regulates the transcription of several late competence genes as well as comK itself. It has been found that ClpX plays an important role in the regulation of ComK at the post-transcriptional level.
Statistics
?
PSSM-Id: 399384
Aligned: 19 rows
Threshold Bit Score: 171.685
Threshold Setting Gi: 75457698
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5HQD5         6 ETIY-VIRKGDMVIRPKYDEYQQTNGTEIIRFDQtrKESPFKVQRIIERSCKF-YGNNYISKKAETNRITGISSKPPILL 83  Staphylococcus ...
WP_015593455  39 FEKY-VINPKTVLITAEFDQKGHLFSRVIEGKKT--FIVTMHPKALVDYSLRY-YCSSLKGALEGSRSILGNISMQPIMI 114 Bacillus sp. 1N...
CCG44594       6 KKEY-EVNPQTMALIAKYDQQGQVITHVVEQHGS--FEVLKCPSQVVDDSCRY-FASSLEGRILGTKQVTSYTHKPPIVI 81  Halobacillus ha...
Q8ERX0         3 KQQYlEITPFTLAVVSEQDENGRYIAKVLEEEAE--YVLEAKPTNVIDYACKY-FGASLKGRQEGTREISGITHKAPITI 79  Oceanobacillus ...
WP_015009519   6 RTSY-ELSQATMALIAT-EIDGLWGSIVYEEGASkpIYVAEPPTKIIEKAHKQ-NGEELLARADAAKVVCGFNNKPPVVI 82  Amphibacillus x...
BAH18253       2 mAKY-IITERTMYIKSHFEQKQHL--SLVGEFNEtpFIVEERPLSIIETSCVF-YHSSYNNRKLATKLIANITTKPPIVV 77  Macrococcus cas...
WP_012726947   7 EEKY-RITKRTVAILPCFDIMKQ--SRIILEDGTe-ISTPLRPYQLLQLSCRQ-YNSSIEERIFIAKRVAGVKGKVPVVI 81  Exiguobacterium...
WP_012371295   7 DEKY-RITKRTVAILPCYDMMKQ--SIIVLEDGSt-IMTPLRPYQLLQLSCRQ-YNSSIEERIVTAKRVSSVKGKVPVVI 81  Exiguobacterium...
MA:Aflv_2650   4 MEEY-MIMEETAALVPKYDSYGRLGTIVYELYNT--YKVDQSPKEIIQQSCRY-YGSTYEGKVHAAKHILGIRQMVPISV 79  Anoxybacillus f...
Q6HQP8         3 dENAiIISNSTMMLEPY--KHPSYCTKMIDSSGNh-LYSCQTALQLIKKSCLTnVHTTYQGRRKAVQTNFNFKQNVPIPI 79  Bacillus anthracis
Q5HQD5        84 TPLFPTYFFPTHSDRQEENIWINMHYIENVKELKN-RKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSR 159 Staphylococcus epi...
WP_015593455 115 NTQLDICWFPCFSPERNDCVWFSLTHIVNTEKLSL-KQTIVNLNFGHNIMLDMKRERFENKRQRASQLRYISSQRTK 190 Bacillus sp. 1NLA3E
CCG44594      82 SEAMGIYFFPIISPKRKECSWIALKYIQTHKGESD-HTTTIQFSNGTSLNLPVSVGMFANQLHRTAHFRFILEDRLh 157 Halobacillus halop...
Q8ERX0        80 DPASGMYFFPTKSPSNANCSWIAHSHIKEVRREEE-GKTSVLFKNGSKISLDISHGSLINQLQRTAQIRFLLDDRIK 155 Oceanobacillus ihe...
WP_015009519  83 SITKNLYYFPTHSPSNPNCSWFSHTHSTTVSKAKY-GGAIVHFRNGHKLEIPVSEMIMTNQLYRTAQFRFMIDQQIQ 158 Amphibacillus xylanus
BAH18253      78 DPGCNAYFFPTHSDRSKEQSWINLQYVDHYKEGEF-LDTIVYFDDKSNISVPISKYVFNSQFINTIKLEYSLRTKLK 153 Macrococcus caseol...
WP_012726947  82 EPTTGLVFFPTKSPKRDDCEWYAWSHIRDILNVEGePNGLVLTTDGHQIQTNATPYVLRNQLKATGELVARFQQLNa 158 Exiguobacterium sp...
WP_012371295  82 EPTLGLVFFPTKSPKRDDCEWYAWSHMSEVIEEDG--QTKLKTRNGMILPVNASPYIVRNQMKATGELMARYQQLNA 156 Exiguobacterium si...
MA:Aflv_2650  80 CEALRLYFFPTCSPDSDRCIWIAPSHIKMIQPYEK-KKTKVILKNKQELIVDIQKGTFEGKMYKTAMLMVTLQQRMM 155 Anoxybacillus flav...
Q6HQP8        80 NHREYICAFPTESPSSPNCIWLFYNHIDDIEFFKQsKKATIHFSNGTTTTIHISPHRLKQQLLKAGYVLSRMNMQDS 156 Bacillus anthracis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap