Conserved Protein Domain Family
GCN5L1

?
pfam06320: GCN5L1 
GCN5-like protein 1 (GCN5L1)
This family consists of several eukaryotic GCN5-like protein 1 (GCN5L1) sequences. The function of this family is unknown.
Statistics
?
PSSM-Id: 399374
Aligned: 37 rows
Threshold Bit Score: 104.227
Threshold Setting Gi: 301097495
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEB13778                        5 MLKEHQVKQAKLKELQEHKRKEAIGAANNLTQALIDHLNVGVAQAYLNQKKLDGEAKQLYLSAVKFSKQTQQWLSLVESF 84  human body louse...
EPB85709                        8 LLKSHNQKQSEAKKQNEQLKKTAIQTTNELTDSITEYVNDRVTEIFSRQKELEQQSRRLANQTTKYANQTQQWLTLVDDF 87  Mucor circinelloides f. circinelloides 1006PhL...
XP_009381376                   18 IVQEHQQRSIWTREQTDKAKKNALRTAMRVSELLVDTVNGGVEESFINEKRVELEIRALASTIMRYKKQTDQWLAASHAL 97  wild Malaysian banana...
ERM96793                       19 LVHEYNHKTLFIREKTENAKKDALRSGLHVSGLLVDSVNGGVQESFINEKRIEFETRALASTIMRYTKQTNQWLAASHAI 98  Amborella trichopoda...
XP_006362892                   19 IINSHHSSSLKLRESTEKAKKDGIRSARRVSELLVDSVNREVQEAFVMQKRIEMEIRALTASILQFGKQTDQWLAASHSI 98  potato...
EFC48781                        5 LIKEHNQRQQKVREENDKRRHKAKDSLQSVSHELIDQTNSDVIKVFQNQQMIENEAKHLHAQVEKFNKQTTQWIQTFQQL 84  Naegleria gruberi...
WGS:AAGF:cds.TTHERM_00723180A  74 iLKEYEKSKKTVEKENELLKKEIKLLSENITKKVLIGVNSDVQVLHSNQKIIEKETKELKSEVSKFYKEVQSWTALYDDL 153 Tetrahymena thermophila SB210...
Q4D7L8                         90 LIRAHRERQAELRAVGSRAWEEVRQHAQAACDAVTDSANAEVFAAFARERKIEMELKAIAARSSQLQRQMTAWATLFGKF 169 Trypanosoma cruzi...
EGD75368                        5 LVREHSEAKARAKAEAAEAKASASQHLQELAAAVVADLNTEVSQVFANQQHIDKEIQAMQAALAKQKRTAAKWATSVKKF 84  Salpingoeca rosetta...
XP_011112894                    5 MIKEERAARNERLRRADEARKHLTHEITVLGDSLDIDLRDRISNIHSNANALETQSKQLKTRTQAMSKTSRQWSAMAENG 84  Dactylellina haptotyla CBS 200.50...
EEB13778                       85 SNSLKEIGDIENWSKTIENDMKIITTALECAYK 117 human body louse
EPB85709                       88 NMSLKELGDVRNWAEIMEHDMKTIMATLEFVHQ 120 Mucor circinelloides f. circinelloides 1006PhL
XP_009381376                   98 NTVIKEIGDFENWMKIMDFDCKSINAAIRNIHQ 130 wild Malaysian banana
ERM96793                       99 NSAIKEIGDFENWMKTMDYDCKSISASLCNISK 131 Amborella trichopoda
XP_006362892                   99 NTAIKEIGDFENWMKTMEFDCKSINAAICNIHQ 131 potato
EFC48781                       85 NQCVKELGDVENWANHINNDIKYIVNNIEKHQK 117 Naegleria gruberi
WGS:AAGF:cds.TTHERM_00723180A 154 NGALKELGDVVNWAGIIEKEFKIIVEKMEEQKI 186 Tetrahymena thermophila SB210
Q4D7L8                        170 NTELKEMGDLSNWARRIEEDLSETVHLLEELSE 202 Trypanosoma cruzi
EGD75368                       85 NQALKEIGDVENWAATLENDMRKVVDAIQIAKR 117 Salpingoeca rosetta
XP_011112894                   85 RGRLKEIGDVQNWAEMIERDLLILEETLRIVND 117 Dactylellina haptotyla CBS 200.50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap