Conserved Protein Domain Family
MmcB-like

?
pfam06319: MmcB-like 
DNA repair protein MmcB-like
This family includes Caulobacter MmcB (CCNA_03580), which is involved in DNA repair. It has been proposed to be an endonuclease that creates the substrate for translesion synthesis.
Statistics
?
PSSM-Id: 399373
Aligned: 10 rows
Threshold Bit Score: 208.831
Threshold Setting Gi: 81351469
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5FPB4          7 ENPAatSCGLPETQLAIRRAVLGLCRTINWAAINEFALpAAGRRADIMALLPDHSLTCIEIKSGLRDFQTDQKWPEYRDW 86  Gluconobacter ...
Q3SWG1         11 MVPP--DRRQSATALAIARGTGRLLRSLGFACLSELSL-PSGRRADLVAVNARGEIWIVEIKSSADDLRADRKWQDYRAH 87  Nitrobacter wi...
WP_011083725   11 VPPP--DRRQSETALAIARGTARLLRSLGFSCISELPL-PSGRRADLVALNERGEIWIVEIKSSVEDLRADQKWHEYRAH 87  Bradyrhizobium...
BAF90649        5 APVPkpDGRQSQTAAAIQRGVLRFLAAHGQAGLPEVSL-ASGRRADVLALDAKGALSIIEIKSSVTDFRTDAKWPEYRPF 83  Azorhizobium c...
jgi:Snov_4009   6 LVMPi-DGRQSEMARAIQRGALRYLGARGLVGVPEFSL-ASGRRADIAAIDMRGEVWVVEIKSSVIDFRTDRKWTDYRFH 83  Starkeya novel...
WP_013654972   14 lDDPltDGRQSETALKVWRGAARLLRSLDFACLSEVVL-ASGRRADLLALGPRHELVIVEVKSSVADLRADSKWPDYRLH 92  Polymorphum gi...
jgi:Oant_0151   8 QTHPlsDGRQSENAMLVRRGVQRLFLEMGLATLPELPL-ASGRRADLMAVNRKGEIWIVEIKSSIEDWKADHKWPEYRAY 86  Ochrobactrum a...
Q92TA2          8 GDNPlaDGRQSERAMKVRRGVQRLLMELRHAALPELTL-ASGRRADLISLSPKGEIWIIEIKTSIEDFRVDRKWPEYRLH 86  Sinorhizobium ...
vbi:Avi_0062   33 VKNTliDGRQSERALMIRRGTQLLLDQMRHAVLPELSL-ASGRRADLISVSDKGEIWITEIKSSIEDFRVDRKWPDYRQH 111 Agrobacterium ...
Q7D2A6         38 NNNPliDGRQSDKAMLVRRGVQVLLHEMRHSVLPELPL-ASGRRADLISLSAKGEIWIIEIKSSIEDFRVDRKWPDYRLH 116 Agrobacterium ...
Q5FPB4         87 SDRLFFAVDDGFPLDLIPPDVGLIVVsvsavpaalrDSILAEctIIREPTLHKLAPARRRTLLHLFATTAASRLMSLEDP 166 Gluconobacter ...
Q3SWG1         88 CDRLFFAFTRDLRCDIFPGDTGLIVA----------DAYGAY--LHCEAPEHRLPSPTRKAMMLRFGMAAAQRLNRLADP 155 Nitrobacter wi...
WP_011083725   88 CDRLFFAFTQDLPCEIFPQGTGLIIA----------DAYGAH--LHCEAPEHKIAAATRKQMTVRFAMAAALRINRLVDP 155 Bradyrhizobium...
BAF90649       84 CDRLLFAVGVDFPLELLPDDVGILVA----------DAFGAE--LIRAAPEHPLAAATRKALTLRFARAAAGRLAGLYdp 151 Azorhizobium c...
jgi:Snov_4009  84 CDRLFFAVGPDFPLDILPEDTGIMVA----------DQFGAG--LIREAPHHPMPGATRKALTLRLARTAAGRLMGLMDp 151 Starkeya novel...
WP_013654972   93 CDRLYFATHPGVPAEIFPDDAGLILA----------DGFGAE--ILRDAPEHRLTAATRKALTLRFARHAALRLHDLADp 160 Polymorphum gi...
jgi:Oant_0151  87 CDRLFFATHPAVPREIFPQECGFILS----------DGYGAE--IMRDAPEHKLPGATRKALMLRFARAGAARLTIAELA 154 Ochrobactrum a...
Q92TA2         87 CDRLFFATHAQVPLDIFPEECGLMLS----------DGYGAH--MLREASEHRLPPSTRKSVTQAFARTAAQRLTLAEWA 154 Sinorhizobium ...
vbi:Avi_0062  112 CDRLFFATLPDVPQEIFPQECGLIVS----------DGYGAH--LLRDAPEHRLAPATRKSVMLAFSRAAAQRLMRAEWD 179 Agrobacterium ...
Q7D2A6        117 CDRLFFATHPEVPTDIFPEECGLILS----------DGYGAH--MLRDAPEHKLPPATRKSVMLDFSRTAATRLMLAEWT 184 Agrobacterium ...
Q5FPB4        167 A 167 Gluconobacter oxydans
Q3SWG1        156 Q 156 Nitrobacter winogradskyi Nb-255
WP_011083725  156 Q 156 Bradyrhizobium diazoefficiens
BAF90649      152 d 152 Azorhizobium caulinodans ORS 571
jgi:Snov_4009 152 e 152 Starkeya novella DSM 506
WP_013654972  161 d 161 Polymorphum gilvum
jgi:Oant_0151 155 G 155 Ochrobactrum anthropi ATCC 49188
Q92TA2        155 A 155 Sinorhizobium meliloti
vbi:Avi_0062  180 A 180 Agrobacterium vitis S4
Q7D2A6        185 T 185 Agrobacterium fabrum str. C58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap