Conserved Protein Domain Family
AceK

?
pfam06315: AceK 
Isocitrate dehydrogenase kinase/phosphatase (AceK)
This family consists of several bacterial isocitrate dehydrogenase kinase/phosphatase (AceK) proteins (EC:2.7.1.116).
Statistics
?
PSSM-Id: 399371
Aligned: 61 rows
Threshold Bit Score: 650.736
Threshold Setting Gi: 81564313
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_025371035    23 LAAEILAGFNRHYSLFRFVAQRAKALFESHDWHGMQRVNRERIDYYDTRVRECTRQITQLLDRTRMAMQdprlgnaafte 102 Advenella mim...
WP_014773858    10 tvQTITLGFENYIDEFNKLTQLAAVYFAQRNWKLMHENHRNRLRLYKDFVQQCRNALEEQLQTKVSDLE----------- 78  Belliella bal...
jgi:Echvi_3645   9 vVQKIIDAYHKYITSFHEHTKRAPIYFRERDWDGVQLNHRQRLRLYKDCVNEVVASCKESYGEYLKDRQ----------- 77  Echinicola vi...
jgi:Cycma_3058   9 IVETILNGYDTYISDFKQITLRIPENFKNRDWQQLHANHRERLRLYKDQLKAIITTCKALLNEKADNKE----------- 77  Cyclobacteriu...
BAM01195        34 aASAIHSAFEDYHRAFKAITHRAQERFERREWTKWQSDSIERLELREQIIQRLVSGLRTMLGEQVNSRY----------- 102 Caldilinea ae...
A7HB82          11 gAAAIAASFEAYQEERARITRRARERFEKRDWAAGQADARERLDLRDRLVNACVGTVRAELGGAAHDHG----------- 79  Anaeromyxobac...
Q2IJI0          12 aAEAIRAGYEAYQAERARITARARGRFEARDWAGAQRDARERLDLRDGVVHRTVGEVRAELGGAVQDRE----------- 80  Anaeromyxobac...
jgi:Fraau_0100  20 aAALVLDAFEDYNARFSDITRRARRHFERRDWRQSAADMQARIRLYDECIRETQGRLDSLLDDGLRSRA----------- 88  Frateuria aur...
Q8P4D0          17 IGRAVYEAFQDYHAQFSQITARARQRFETRDWSGAREDAVARIALYDHYISECMLRLRAVLLGQAHDRA----------- 85  Xanthomonas c...
AER54793         7 VASLIAEAFADYHAQFAAITQRARRRFEQRHWSAARADAVERIALYDACINECRLRLQAVLGQRAFDRT----------- 75  Pseudoxanthom...
WP_025371035   103 eqsqYWQDIKQAFTQLLLEHSQPECAETFFNSVCSRIMHRDYFHNDYLFVRPAVATDYIDAQGSSYRVYYPHT-HGIVAT 181 Advenella mim...
WP_014773858    79 ----FWHKSKQQYSDQISKRKDKELAETFFNSVIRKTKPNLAIDEKLMFVHEGYDSCDIHSTENLYHTYPSA--WGLQKI 152 Belliella bal...
jgi:Echvi_3645  78 ----FWIDVKTAFSKAINTRKDKELAESFYNSVIRKAVSDLSIDEELMYVLEGYDSCEIHSQEPLFHNYPSH--WGVQKI 151 Echinicola vi...
jgi:Cycma_3058  78 ----VWAKIRESYFHAIASNEDRELAGTFFNSVFRKVFPGKLIDESLMFYDLSGTNEMDSIDESLFRNYPAQ--VELHDA 151 Cyclobacteriu...
BAM01195       103 ----VWIAIKDAYARQINQRKDVELAETFYNSVTRRILTTIGVDPALEFVWFGATTLPTGGT-PIVRVYTQV--GSLEAM 175 Caldilinea ae...
A7HB82          80 ----LWRAMKELYEARVESRPDREIGQSFFNSVTRRVFVTVGVDPAIEFLAADGPAVREGPV-PVYARYRRE--VSTEAL 152 Anaeromyxobac...
Q2IJI0          81 ----VWRRAKEAFEAVAAARPDAEIAGSFFNSVTRRVLTTVGVDPAIEFLAADAPPPREDP--PQHRAFARE--ATTEAL 152 Anaeromyxobac...
jgi:Fraau_0100  89 ----LWAGMRLEYAARLQDKLDAELYKTWFSTLSRRNFHTRGVDELVEYVALEREAVDAATPLPPLHSYVVH--GDIART 162 Frateuria aur...
Q8P4D0          86 ----LWMRARTHYAELLTGLIDQELYKTFYNTLTRRYFRTQGVDAQIEFIALDIEPTDAITV-PVARHTYAVSpGRLTEM 160 Xanthomonas c...
AER54793        76 ----LWQAIRDHYAALIEGQIDRELYKTFYNTLSRRFFQTRGVDAQIEFVALDIAPTDAITH-PVARHSYAVSlKRPTDT 150 Pseudoxanthom...
WP_025371035   182 VIDMVADFGLALPYHDLPADARLVARRavgvLRREIIktgGSRIAPDCQIHVLRSLFFRNKGAYIIGRFINNGQLYPFSI 261 Advenella mim...
WP_014773858   153 IKRLLADFDFGVKYMNQEEDIIFLENT----IKKVILs--RYKVDDSTVTQVLKKVFYRNKAAYLIGRTYVGEKWMPFII 226 Belliella bal...
jgi:Echvi_3645 152 IRKILEDFDFQAPYYQREKDVQYLVRS----IREVILt--RYKVDENTTTQVLKQVFYRNKAAYLIGRTFLGGKWMPFII 225 Echinicola vi...
jgi:Cycma_3058 152 FTKILEEFDFGVPYYQKEKDINFLVES----VKKVILs--RYKATKETTTQVLRDVFYRNKAAYLIGRTYLGNKWMPFII 225 Cyclobacteriu...
BAM01195       176 IKAILCDYQFAAPYEDLEGDARRVARAmehaLRY------YWDTPDFDVIEMVKSVFYRNKAAYLVGRIRKRNRVIPIIL 249 Caldilinea ae...
A7HB82         153 LRTVLRACAFAAPYEDLERDARIAAIEldshLRE------LDDGQPIEALELVKAVFYRGKGAYLVGRLRRGRYTTPLVL 226 Anaeromyxobac...
Q2IJI0         153 LARILRAAPISAPFEDLARDARLAALEldahVRG------LPDRQPIDAVELARPVFYRGKGAYLVGRIRRGRHLTPLVL 226 Anaeromyxobac...
jgi:Fraau_0100 163 FHVLLDDFRPACGYADIARAVDLLATA----FRQRLLd----HLGAVIQLDMLTAVFYRDRRAYLVGRHVSLQGSAPLVL 234 Frateuria aur...
Q8P4D0         161 LVRVLGDYPFEVPYAHRTRCAAAIAVRllddLA-------HWGEHPVRSVELLETVFYRERRAYLVGRLFGEHRFSPCVI 233 Xanthomonas c...
AER54793       151 FQRVLGDYAFDVPYAHLTRCAAAVAVRlqdeLA-------DWGQDPVRAIELLDTVFYRERRAYLVGRVLGESRFAPCVI 223 Pseudoxanthom...
WP_025371035   262 PLLHTPAHeVRLHALLHTRADISTLFSFTRAYFLVDMETPSSYVSFLQTLMPAKPKAELYTAIGLQKQGKTLFYRDFLHH 341 Advenella mim...
WP_014773858   227 PILNGPKG-IFIDTMIFDPKVMAHMFSFSRSYFMVEAEIPSQMVSFLNAVISHKQIHELYNAIGFNKHGKTEFYRDFLNH 305 Belliella bal...
jgi:Echvi_3645 226 PFLNGPKG-IYVDTLIFDPNLMSAIFSYTRSYFMVETEIPSQIVAFLNSVIRHKKVYELYNAIGFNKHGKTEFYRDFLNH 304 Echinicola vi...
jgi:Cycma_3058 226 PFLHNEKG-IFADTLIFDPNIMSGIFSYTRSYFMAPIAIPSQTVNFLQSVIQHKRPYELYNAIGFNKHGKTAFYKDFTNH 304 Cyclobacteriu...
BAM01195       250 PLLHEDRG-IYVDAALFSEEEASVVFSFTRAYFHVDAEIPGDLVGFLKSILPLKPIAELYIAIGYHKHGKTERYRALYRH 328 Caldilinea ae...
A7HB82         227 ALVHGERG-VVLDAILFTQEDVSIVFSFTRSYFHVEVERPRELVAFLSTLLPLKRVSELYIALGFNKHGKTELYREIARH 305 Anaeromyxobac...
Q2IJI0         227 ALAHGDRG-VALDAVLFTEEDVSIVFGFTRSYFHVALERPRAMVAFLSTLLPLKRRSELYTGLGYHKHGKAELYREVAQH 305 Anaeromyxobac...
jgi:Fraau_0100 235 VLAQSPQG-VVVDALLTEMADISALFDYSHSYFHADIAPVGSVVAFMHVLLPRKPLEELYTVLGRAKQGKTERYRRLFQH 313 Frateuria aur...
Q8P4D0         234 ALVNDDAG-LRAEAVLTRRSDVAQLFSNSRSYFQADLTTVGDAVVFLRSLLTHKPIDELYTMLGRAKQGKTERYRTFFRH 312 Xanthomonas c...
AER54793       224 ALVNDEAG-LRVDAVLTRRAEVAQLFGISRSYFQADLPTVGDAVVFLRTLLPHKPIDELYTVLGRAKQGKTERFRTFFRH 302 Pseudoxanthom...
WP_025371035   342 LT-HSTDTFDIAPGIEGMVMTVFTLGSYPYVFKLIRDKIRKDG-MEHKTVRQKYQMVKLHDRVGRMADTWEYSLVALPRH 419 Advenella mim...
WP_014773858   306 LN-QSKDQFVVAEGILGMVMTVFTLPSYNIVFKMIKDHFEPPKnMTRQEVREKYKLVSLHDRVGRMADTHEFEFFRLPLE 384 Belliella bal...
jgi:Echvi_3645 305 LN-TSNDQFTVAPGIKGMVMTVFTLPSYNIVFKVIKDHFDPPKnMTRQEVKDKYRLVSLHDRVGRMADTHEFEYFQIPMD 383 Echinicola vi...
jgi:Cycma_3058 305 LE-QSEDHFILAEGIKGMVMTVFTLPSSNIVFKLIKDHFEPPKnMTRQQVKEKYKLVGLHDRVGRMADTHEFENFRLPLN 383 Cyclobacteriu...
BAM01195       329 LN-NSNDKFEIARGTKGMVMTVFTLPSYDMVFKVIKDQFAYPKtTTRQQVMERYRMVFQHDRVGRMVDAQEFEGLTFSRD 407 Caldilinea ae...
A7HB82         306 IA-ETGEAFVPARGDKGLVMSVFTLPGLDVVFKVIKDEFKPPKqTTRREVMDKYRHVFRHDRAGRLVDAQEFEHLAFPAD 384 Anaeromyxobac...
Q2IJI0         306 LA-EGDDRFVPARGDRGLVMCVFTLPGLDVIFKVIRDRFAPPKqTTRREVMDRYRHVFRHDRAGRLVDAQEYEHLAFPAA 384 Anaeromyxobac...
jgi:Fraau_0100 314 FRqHPGDRLVHAEGKRGMVMLVLTPIRLPVVIKLIRDRFVWPKdMKRRDVEEKYRLVMLHDRVGRLVDAQEFRQLRLARA 393 Frateuria aur...
Q8P4D0         313 FQaHPAEQLVHADGTPGMVMVVFTLPSYPLVFKLIRDRFAYPKtMSRAQVEGKYELVFQLDRIGRLLDAQPYRFLRFPKA 392 Xanthomonas c...
AER54793       303 FNeCAHEQLVQAEGTPGLVMAVFTLPSYPLVFKLIRDRFAESKqVTRKDVQDRYALVFSRDRAGRLLDAQPYRSLRFPVA 382 Pseudoxanthom...
WP_025371035   420 RFSEALLKELRTEVPSLIEETETAIVFRHVYIERRMTPLNLYLNRASDAALEDAVRGYGDAIAELAAANIFAGDMLYKNF 499 Advenella mim...
WP_014773858   385 RIHPAMLQELKNTSNSLLLTTEKELIIKHLYTERKMIPLNLYLDECSHEDAKQAVEDYGNCIIQLAQANIFPGDMMIKNF 464 Belliella bal...
jgi:Echvi_3645 384 RVHPDLLKELKNTVNSLIKIDGDTLFIKHLYTERRLTPLNMYLEDCTLEDAKIAVEEYGNAILQLAKANIFPGDMMTKNF 463 Echinicola vi...
jgi:Cycma_3058 384 RIDPLLMKELKTNVNSLLSIEGDTLVIKHLYIERRLRPLNLYLETCSLEEAKHAVDEYAKAILQMAQANIFPGDMMTKNF 463 Cyclobacteriu...
BAM01195       408 RFSPELLKELQESAAKTVTITDDEVIIKHLYTERRLYPLDLYIKEMSFERARAAVIDYGQAIIDLATANIFPGDLFIKNF 487 Caldilinea ae...
A7HB82         385 RFSPEVLRELSEECRGSIEIGRAEISVKHLYAERRVTPLNLFIREADEWTARQAVLDFGRALKDLAATNTFPGDLLLKNF 464 Anaeromyxobac...
Q2IJI0         385 RFSPALLEELRTECGDGVRVAGGEVAIRHLYAERRVTPLNLFVREADEWTARQAVLDFGCALRDLAATDTFPGDLLLKNF 464 Anaeromyxobac...
jgi:Fraau_0100 394 CFPDELLTELMAECGSSVSEEGDDIVISHCYIQRRLRPLDLYLREVEPEAARRAVLDYGQAIKDLAGSRLFPGDMLLKNF 473 Frateuria aur...
Q8P4D0         393 RFSPALLQDLQSSCAMSLSEDGDDVLIALCYVQRRLRPLNLYLREQLPAAAHAAALDYGQAIKDMARNNIFPGDMLLKNF 472 Xanthomonas c...
AER54793       383 RFAPALLAELRDTCAGSLEFEGEDVIIALCYVQRRLRPLNLYLREQPAEAARAAVLEYGQAIVDMARNNIFPGDMLPKNF 462 Pseudoxanthom...
WP_025371035   500 GVTRLGRVVFYDYDEIQPVTEMVFRRIPPA--PNEEAEM---------SDEPWYAVHPNDVFPEEFERFLLGDPRVRRAF 568 Advenella mim...
WP_014773858   465 GVTRQKRVIFYDYDEIEFLTDMNFRWKPKA--ETYEQIY---------ASSPWYDIAKNDVFPEDFKSFMIGRADVKQHF 533 Belliella bal...
jgi:Echvi_3645 464 GVTRQKRVIFYDYDEIEFLTKMNFRIKPKP--VTFDQIY---------ASRPWYEIAKNDVFPEDFKRFMIGRSDIKPHF 532 Echinicola vi...
jgi:Cycma_3058 464 GVTRQNRVIFYDYDEIEFLHCMNFRAKPKP--QTYDQIY---------ASRPWYEIKENDVFPEDFKRFMIGRQDVKAYF 532 Cyclobacteriu...
BAM01195       488 GVTRHGRVVFYDYDELCLLTDCNFRKLPAS--RDYDDEI---------ADQPWFPVAPNDIFPEEFRKFLWFPAPLRKVM 556 Caldilinea ae...
A7HB82         465 GVTRHGRVIFYDYDELTRVTDCVFRDLPTP--SGDDEET---------SGEPWFYVGQDDVFPEELLPFLGLAGRLREVF 533 Anaeromyxobac...
Q2IJI0         465 GVTRHGRVIFYDYDELTRVTDCNFRDLPGAgpGDGDDGWgggpdagydGGDPPFYVGPADVFPEELLPFLGLTGRLREVF 544 Anaeromyxobac...
jgi:Fraau_0100 474 GVSRAGRAIFYDYDEVCALDDCHFRALPPA--RPGEEML---------PLEDRVYAAPGDVFPEMFIHFMGVGAELRRLL 542 Frateuria aur...
Q8P4D0         473 GITRHQRAVFYDYDELCLITECTFRDWPTP--TSYEEQM---------AAEPWFHVGPRDVFPERFALFMGLPSSQLEAV 541 Xanthomonas c...
AER54793       463 GVSRHGRVVFYDYDEVRLITDCSFRDWPRA--QNFEEQM---------ADEPWFQVWPGDVFPERFAQFMGLPPALAQAL 531 Pseudoxanthom...
WP_025371035   569 LKYHAPLLDYQWWQNRQSRVASGKIEDIFPYPAE 602 Advenella mimigardefordensis
WP_014773858   534 LDYHKELFNPDYWVSIQSQIKAGELLHAFPYSKS 567 Belliella baltica
jgi:Echvi_3645 533 FEFHKLLFDPEHWQKIQGRIEHGELIHAFPYPEY 566 Echinicola vietnamensis DSM 17526
jgi:Cycma_3058 533 IENNPELFDPEYWSGIQSKLKKGELIHAFPYPES 566 Cyclobacterium marinum DSM 745
BAM01195       557 EEHHGQLFTVEFWQELQRRVRSGEVIDFFPYAPE 590 Caldilinea aerophila DSM 14535 = NBRC 104270
A7HB82         534 LQAHGDLLTARYWRAIQERIREGEIVDIYPYREE 567 Anaeromyxobacter sp. Fw109-5
Q2IJI0         545 LRAHGELLTGRWWRDIQARLRAGEIVDIFPYREE 578 Anaeromyxobacter dehalogenans 2CP-C
jgi:Fraau_0100 543 GEAHPELFDPAWWQGLQARLRSGEYVDVPPYPRR 576 Frateuria aurantia DSM 6220
Q8P4D0         542 KHMHPELFDPQWWRDLQARLREDDYPDTPPYADA 575 Xanthomonas campestris pv. campestris str. ATCC 33913
AER54793       532 QAVHGQLFEPGWWRALQAELAQGRYPDTPPYPPg 565 Pseudoxanthomonas spadix BD-a59
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap