Conserved Protein Domain Family
ACP53EA

?
pfam06313: ACP53EA 
Drosophila ACP53EA protein
This family consists of several Drosophila ACP53EA accessory gland (seminal) proteins.
Statistics
?
PSSM-Id: 399369
Aligned: 12 rows
Threshold Bit Score: 101.254
Threshold Setting Gi: 968087774
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002026614         33 SKLSKCAQVGVEAVAKVVTNVIPAVYEMQICSFYtalPPKDGKPKSSIWYLKNIYRFFKKLVVNNPKCLKLLVTQATELI 112 Drosophi...
Q6GUR9               33 GRLGKCTQVAIETLTSLADKIVPTVYELKQCSGYvtlEPANGKDRKITWYLKVSYEFFKKLVFDEPKCLHGLLNKLAATI 112 fruit fly
XP_001960629         33 SRLAKCGQVAVEVLSSLATKTIPTIYQLKKCSGFvaiDAPNGR-MRITWYLRNIYEFGKSLVIDQPKCVEKLLTSVALLV 111 Drosophi...
XP_002026615         29 DKYLQCFEVINDGVSLLIENTIPAIKILVLCIDY---QPQLEKGNSFLKYIRIVHQFAKKAIYHKPDCLIQMFSAAVTLL 105 Drosophi...
AIZ50463             30 DHYLRCLEVVTDAGALMIENSITAISLLSDCVDF---QPKLKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFTTGVGLI 106 Drosophi...
XP_001960630         30 EKYLRCLEVVADAGAIMIENSVTAVRALSECVEF---EPKIKLTGSILRYIKLAHQFLKRAIYDKQVCLIRTVTTAVNLV 106 Drosophi...
XP_002026613         29 EKWLECTHIGARASAQILRRTIPAMRVLYQCIDF---EPLRDPEFSQLRLLKNIYKFLKLSVYDKQSCLLDPLKGVVNTL 105 Drosophi...
Q9GNB3               29 EKWLACNRIGTKALGSLLRETIPTVRNLLNCIDY---NPPTDIGSSYLSKLTLYYELLKRGALDKTQCLIVPLKESVRLL 105 Drosophi...
XP_001960628         27 EKFLSCSRQGAQAAASLIRESIPALRSLLICIDY---APPTSPRRSYLRSLKISYEMLRRGAFEKPNCIIEPLRGAANIL 103 Drosophi...
WGS:AAPU:GI18622-PA  29 fKVLDCAEIAIAAGGYVAVRAVPLVKDLAKCTNF---NTDANANLDIKGFIEVVNQFLKQSS-GSPKCLQTTLDTIKGYV 104 Drosophi...
Q6GUU4               32 NRLSECTESGLKVAATLISRAIPCVKKLAKCADF---RAIKTKDLDITGLALLGYQYLQKVV-NNQRCLLITLKESYDAV 107 Drosophi...
XP_002061036         31 EKAVQCAEILAIAGGAGLTSAPPIAKKFIGCTGF---KATKTKSLDETDVFLLIGSLVQKSI-ANPSCVMSALSEVKKVV 106 Drosophi...
XP_002026614        113 KPYSEQIEELECL 125 Drosophila persimilis
Q6GUR9              113 KPFAEQISGLGCL 125 fruit fly
XP_001960629        112 KPYAEQIAELACL 124 Drosophila ananassae
XP_002026615        106 KPQERKLDSLNCF 118 Drosophila persimilis
AIZ50463            107 RPIIAKFDSLRCF 119 Drosophila sechellia
XP_001960630        107 RPLVAKFDSLNCF 119 Drosophila ananassae
XP_002026613        106 EPYVERIDSMHCL 118 Drosophila persimilis
Q9GNB3              106 RPFIKSLETNKCL 118 Drosophila simulans
XP_001960628        104 KPFVKQIEILKCL 116 Drosophila ananassae
WGS:AAPU:GI18622-PA 105 EPFVKQITEAKCF 117 Drosophila mojavensis
Q6GUU4              108 SPYIEKLISENCV 120 Drosophila simulans
XP_002061036        107 APHVTKFIAAKCI 119 Drosophila willistoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap