2HH6,2O4T


Conserved Protein Domain Family
DUF1048

?
pfam06304: DUF1048 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1048)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399365
Aligned: 12 rows
Threshold Bit Score: 125.119
Threshold Setting Gi: 122921409
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HH6_A           9 IGSLNDKREWKAXEARAKALPKEYHHAYKAIQKYXWTSGgPTDWQDTKRIFGGILDLFEEGAAEGKKVTDLTGEDVAAFC 88  Bacillus halo...
tigr:AAur_3849  10 TGSLEQKKQYKQAKARLDALPEPYLTVATAFNRYLMYYGgVTEGDTMVQMFTDLADLWERAAIDGTPVSEIVGEDPIEFA 89  Paenarthrobac...
EDK35527         7 ITGSDMTKELKIFESRAKKLPADYQVAWGKIFANLLPHS-DFTGRNLMPILDGVLGLLEEAAADGQSVQEALGDDIKGFC 85  Clostridium k...
Q9K5W0           7 ITGSDMTKEMKGFETRAKVLPAEYRAAWEEITSNLWLHS-DFTGRNLMPILDSALELLEVASADGQSVEEVLGDDIEGFC 85  Bacillus halo...
Q835S5           9 KKVVGDKKEYKEYKRRIAALPVEYRQVFQEIEKYAWHFS-DHSGANMFNALTDLLDLFEEGAANGTPIKNITGEKVGDFA 87  Enterococcus ...
Q8Y922           6 kKYREEKRDYKQYKKRIAALPEDYKTAMKAIETYLWNFA---KGAGMFEILKNVLEMFENAAADNLELKAVVGDDLAEFA 82  Listeria mono...
WP_012103861     6 KKVVGDKKEYKQQMARVKALPEDYQFVFEKIQRYMWNFA-AGDGYDMLKIQYELIDLFEAGVVEGRQVLEITGEDVAAFC 84  Clostridium k...
Q813B1           6 kKLIGDKKEYKMMMARVEALPEDYQFVFKKIQNYMWNFS-AGNGMDMLHIQYELIDLFEAGAAEGRQVLDITGDDVASFA 84  Bacillus cere...
EDK35526         4 QDIIEGKKEWRAHMVRVKALPQDYQIVYKEIQKYIFKVG-PVELTDGTGLLSGIIDLFEEGAALGKSVLEVTGSDVAAFC 82  Clostridium k...
2O4T_A           1 ----------gAHVSRVEKLPKDYQIVYKEIQKYLFKVG-PVELNEGIGLLSEILGFFEEGAAAGKGVLDVTGTDVAAFC 69  Bacillus halo...
Q9CDZ2          11 MIGLEEKREFHEFENRAQKLGENYYEDYKELKKYIWHSG-VTKWADFKFIFGQVLDLLEEAKIQDKELTDLIGPDVATFI 89  Lactococcus l...
Q9CDZ3           7 SDLLAEKKDWQEMQNRAKKLPKDFYQAYRSIQKYMFKMG-ATDW----HIFNDIIELFELAVVDGRSPAEVLGDDVATFA 81  Lactococcus l...
2HH6_A          89 DELXKDTKT--WXDKYRTKLNDSIG 111 Bacillus halodurans
tigr:AAur_3849  90 ESFAQAYGGkrWIDKERERLNKAIN 114 Paenarthrobacter aurescens TC1
EDK35527        86 SALAGEEGAksFRDKWREQLNNNVA 110 Clostridium kluyveri DSM 555
Q9K5W0          86 AALVGDQGAktFRDKWRDQLNKNVA 110 Bacillus halodurans
Q835S5          88 ETIVNEVAGk-WTDKQKEKLNHQFS 111 Enterococcus faecalis
Q8Y922          83 DNLLSEFPEetWMDKQRQKLRDSIK 107 Listeria monocytogenes
WP_012103861    85 DELLLNAKT--YTENWREKLNHDII 107 Clostridium kluyveri
Q813B1          85 DELVANAKT--YVSKYREDLNESIm 107 Bacillus cereus ATCC 14579
EDK35526        83 DDLIKGSKT--YADIYQESVDQEVN 105 Clostridium kluyveri DSM 555
2O4T_A          70 DALIGDSKT--YADLYQESIQQHVD 92  Bacillus halodurans
Q9CDZ2          90 DEMMDDNS---WGKKQKNKLNKELK 111 Lactococcus lactis subsp. lactis
Q9CDZ3          82 DKLLSDNKEd-WRNKYRQALNDYFA 105 Lactococcus lactis subsp. lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap