3VEB


Conserved Protein Domain Family
MatP

?
pfam06303: MatP 
Click on image for an interactive view with Cn3D
MatP N-terminal domain
This family, many of whose members are YcbG, organizes the macrodomain Ter of the chromosome of bacteria such as E coli. In these bacteria, insulated macrodomains influence the segregation of sister chromatids and the mobility of chromosomal DNA. Organisation of the Terminus region (Ter) into a macrodomain relies on the presence of a 13 bp motif called matS repeated 23 times in the 800-kb-long domain. MatS sites are the main targets in the E. coli chromosome of YcbG or MatP (macrodomain Ter protein). MatP accumulates in the cell as a discrete focus that co-localizes with the Ter macrodomain. The effects of MatP inactivation reveal its role as the main organizer of the Ter macrodomain: in the absence of MatP, DNA is less compacted, the mobility of markers is increased, and segregation of the Ter macrodomain occurs early in the cell cycle. A specific organisational system is required in the Terminus region for bacterial chromosome management during the cell cycle. This entry represents the N-terminal domain of MatP.
Statistics
?
PSSM-Id: 399364
Aligned: 14 rows
Threshold Bit Score: 131.388
Threshold Setting Gi: 47117476
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3VEB_B                2 KYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRH 81  Yersinia...
WP_004244682          2 KYQQLENLECGWKWAYLVKKHREGELITRYVEKSAADEVVEQLLRLESQPLKVLEWINLHMNPELSNRMKQTIRARRKRY 81  Proteus
WP_015422583          2 KYQQLENLECGWKWAYLVKKHREGEEITRYTEKSRAEEAVAQLLKLESHPVKVTAWIQKHMAPGLANRMSQTIRARRKRH 81  Morganella
goetting:EBL_c24760   2 KYQQLENLESGWKWKYLVKKHREGEPITRHLDKGEEQDALKQLLALENEPVKVTDWIVRHMNPALSNRMKQTIRARRKRH 81  Shimwell...
A6T750                2 KYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQAAVDDLLTLENEPVLVHAWIEQHMNPALMNRMKQTIRARRKRH 81  Klebsiel...
Q6D6D5                2 KYQQLENLECGWKWKYLVKKHREGEEITRFLEQSAADDAVQALLKMENQPVKVLEWIAQCMNPTLENRMKQTIRARRKRH 81  Pectobac...
Q6LR94                2 KYQQLENLEAGWKWTYLVKKWKEEEAITCHIDSSEAEAAIQSLLTIEHEPTKVIEWIDKHMSPALENKLKQAIRAKRKRH 81  Photobac...
Q9KS02                2 KYQQLENLECGWKWQYLINKWKDGEPVTRYIDKSEIEAAVQKLRAIEHEPTHVLSWIEEHMSSELDNKLKQAIRAKRKRH 81  Vibrio c...
Q2NU72                2 KYQQLENLETGWKWKYLIKKHREGERISRHEENSAAAESVQQLISYQHQPKKILKWIRESMHPGLENRMKQTIRARRKRH 81  Sodalis ...
Q7VPB1                2 RYQKLEIQEANWQWKYLLKKHREGENITKHTEQSLIELKVQFLTTLQHSPAEIEQWIKAEMTAEQRKRMRQSIRAKRKRF 81  [Haemoph...
3VEB_B               82 FNAE 85  Yersinia pestis
WP_004244682         82 FNAE 85  Proteus
WP_015422583         82 FNAE 85  Morganella
goetting:EBL_c24760  82 FNAE 85  Shimwellia blattae DSM 4481 = NBRC 105725
A6T750               82 FNAE 85  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Q6D6D5               82 FNAE 85  Pectobacterium atrosepticum
Q6LR94               82 FNAE 85  Photobacterium profundum SS9
Q9KS02               82 FNAE 85  Vibrio cholerae O1 biovar El Tor str. N16961
Q2NU72               82 FNAE 85  Sodalis glossinidius str. 'morsitans'
Q7VPB1               82 FNAE 85  [Haemophilus] ducreyi 35000HP
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap