Conserved Protein Domain Family
RelE

?
pfam06296: RelE 
RelE toxin of RelE / RelB toxin-antitoxin system
RelE is a family of Gram-negative bacterial antitoxins of the RelE/RelB toxin-antitoxin system. Its cognate antitoxin is family RelB, pfam04221.
Statistics
?
PSSM-Id: 399359
Aligned: 19 rows
Threshold Bit Score: 137.423
Threshold Setting Gi: 500509262
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3AQ54          1 MRVFKNKWFNHWASREGISDDVLFGAAKEIIIGNVEaNLGGYLFKKRLPRQgkgksgGYRVIVGFKKqnNDRIIYLYGFS 80  Chlorobium chl...
Q9JXT6          1 MRIFKNQWIVKFAKKHKINDSELLEAVERADNGLIDaDLGGGVIKQRIARQgqgrsgGYRSLILFKQ--ADKAFFVYAFA 78  Neisseria meni...
WP_011700226    1 MRVFKTKWFVRYARRERIKDQSLCEAIERAERGMIDaDLGGGVIKQRVGRAgrgrsaGYRVLAAYRC--GDRAVFLYGFA 78  Syntrophobacte...
Q92MY0          3 VRIFKNAWFERFTRKQRIADAALVDAVRRAERGQIDaDLGGGVIKQRVARAgqgksgGYRTIILFRL--EQRAFFVFGFA 80  Sinorhizobium ...
Q7N530          1 MKVFKNAWFERFARKQRIPDEVLLDAIERANRGQIDaDLGGGVIKQRVARKgqgksgGFRTVILYQT--AEHAFFVYGFA 78  Photorhabdus l...
Q2RVX2          2 TRILKRKDFARWQEGEKLPDAALCKAVQEMENGLIDaDLGGHLYKKRVARPgggksgGYRTLLSARI--GSRYAFLHGFP 79  Rhodospirillum...
WP_011812385    2 MRVFKTRHFQRWMRKTELTDAALCKAVEEMAGGSIDaDLGGGVVKKRVGLAgrgkrgGARTLVATNK--GNRWFFVFGFE 79  Verminephrobac...
jgi:Pnap_4308   4 KKVFKTKSFARWARKL-ISDSELCVAALEIEKNLYEaDLGGGVCKKRIAVPghgksgSTRTLVAKRH--ENAIFFIVGRS 80  Polaromonas na...
Q12GA8          2 KRVFKTKTFDRWARKV-VSDLLLCQAASEIEQGLFEaDLGGGVCKKRVAVPgrgtsgSTRTLVAKKH--RSAIFFLAGRE 78  Polaromonas sp...
WP_011951006    1 MSVFMSKSFARFARKAGLASEALIEAASAVAAGQADaDLGSGVFKQRVARSgggksgGYRTIILFKV--GGHSFFAHGFA 78  Sphingomonas w...
Q3AQ54         81 KSQA-ATISKKEEAALKMVSSEFVAYSDEQISRLIQQQYIMEV 122 Chlorobium chlorochromatii CaD3
Q9JXT6         79 KNDR-ENISDKELDVYRKAAAYYLKYTRAELAALKEDGIITEI 120 Neisseria meningitidis serogroup B
WP_011700226   79 KNER-DNIEDDELATLSEIATGWLTANDQGLMRALDGGFLQEV 120 Syntrophobacter fumaroxidans
Q92MY0         81 KSEQ-ANIEDGEEALFKKMAKELLALSDAQMAVLIGKGRFSEV 122 Sinorhizobium meliloti
Q7N530         79 KSDR-SNIEYDEEMQFKKMASHVLGLSDEQLARLIEKGHFSEV 120 Photorhabdus laumondii subsp. laumondii
Q2RVX2         80 KSDK-ANVTQGEKKALQFAGKVLLNLSAEALSKALQSGVLLEV 121 Rhodospirillum rubrum ATCC 11170
WP_011812385   80 KNDR-ANISDEELEGLQTIATDLLARTGKQLDEAVADGTLQEI 121 Verminephrobacter eiseniae
jgi:Pnap_4308  81 KSDPgADFSPTEETVAKAYAGLLQKASLSKLNQMKVNGALVEI 123 Polaromonas naphthalenivorans CJ2
Q12GA8         79 KSQPgSDFSDKEVDATKIIASRLQAADAQKLDELLAAEILKEI 121 Polaromonas sp. JS666
WP_011951006   79 KNEK-ANISAKELKALKLLAALYLGYSAEEITAAVNGGALIEV 120 Sphingomonas wittichii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap