2EE7


Conserved Protein Domain Family
CH_2

?
pfam06294: CH_2 
CH-like domain in sperm protein
Spef is a region of sperm flagellar proteins. It probably exerts a role in spermatogenesis in that the protein is expressed predominantly in adult tissue. It is present in the tails of developing and epididymal sperm internal to the fibrous sheath and around the dense outer fibers of the sperm flagellum. The amino-terminal domain (residues 1-110) shows a possible calponin homology (CH) domain; however Spef does not bind actin directly under in vitro conditions, so the function of the amino-terminal calponin-like domain is unclear. Transcription aberrations leading to a truncated protein result in immotile sperm.
Statistics
?
PSSM-Id: 399357
Aligned: 153 rows
Threshold Bit Score: 58.9719
Threshold Setting Gi: 195165059
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EE7_A         20 LYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWGHLnRKVLKRLNFSVPDDVMRKI 99 
XP_023184085   15 VIKWLQDLELSFHPRNLRRDLSNGYLVAEIFSRYYPHDISVYSYHNGVSFSSKQKNWSRI-QKFLKKKNLELSKEVIYGS 93  southern platy...
XP_002709370   55 VLRWLQGLDLSFSPKNIKRDFSNGFLIAEIFSMYYPWDLQLSSFENGTSLKVKLDNWAQL-EKFLARKKFKLPKELIHGT 133 rabbit
XP_003773100   47 VLRWLLSMELTYYPKNINRDFSNGFLLAEIFSIYYPRDLKLITFENGNSIKSKLANWAQL-EKFFSKKHFKIPKELIHGT 125 Tasmanian devil
12_pfamImport   1 VLKWLQSLDLSFSPKNFRRDFANGYLIAEIFYWYFPEDIQLHSYENGTSLANRLSNWSQL-EKIALRXNFNQGRQILLST 79 
Q5XLA5         12 VLRWLLSLGLSVSPRNYRRDFSNGYLVAEILSRRFPAHIQPDAYRNGCSLAAKLSNWSQL-RRFLAKQEFDIAQELIEGT 90  chicken
EKC20206        8 VLKWIQSLDLTWQIKQAKWDLTNGYLIAEIFSWYFPQDIQMHSYNNGTSLDSKLKNWSLL-KLFIKRHKLEIPEELIEGT 86  Pacific oyster
EDO30183        8 ILKWIQSLDLSHPVKNTKRDFSNGCLVAEIFSWYYPQEIQMHSYDNGASLATKMGNWSQL-QTFFQRQGFGISKEVIDGT 86  starlet sea an...
XP_030837046    9 VFKWIQSLDLTFPIKNVRRDFSNGYLVAEIFSWYFPEDIQMHSYGNSSGLQGKLGNWSLL-RTFFKKRGLEIPYELIDGT 87  purple sea urchin
XP_014321220   55 iLRWLQSLDLTFFPRNINrDFSNGFLVAEIFAIYYPWDLSLSSFKNGTSLRVKLDNWAQL-EKFLAKKKIRLPRELIYGT 133 little brown bat
2EE7_A        100 ----AQCAPGVVELVL 111
XP_023184085   94 ----IHCEPGAAEQLV 105 southern platyfish
XP_002709370  134 ----IHCKAGVPEILI 145 rabbit
XP_003773100  126 ----LHSIPGVPEILI 137 Tasmanian devil
12_pfamImport  80 lahkVH-----PQNTV 90 
Q5XLA5         91 ----IHCKPGAAESLL 102 chicken
EKC20206       87 ----IHCKEGAAPALC 98  Pacific oyster
EDO30183       87 ----IHCKPGAAALLV 98  starlet sea anemone
XP_030837046   88 ----IHCRPDAAELLV 99  purple sea urchin
XP_014321220  134 ----IHCKAGVPEILV 145 little brown bat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap