3NCT


Conserved Protein Domain Family
PsiB

?
pfam06290: PsiB 
Plasmid SOS inhibition protein (PsiB)
This family consists of several plasmid SOS inhibition protein (PsiB) sequences.
Statistics
?
PSSM-Id: 399353
Aligned: 9 rows
Threshold Bit Score: 212.631
Threshold Setting Gi: 491106431
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NCT_A                    4 ELTLNVLQTXNAQEYEDIRAAGSDERRELTHAVXRELDAPDNWTXNGEYGSEFGGFFPVQVRFTPAH-ERFHLALCSPGD 82 
KFC76646                  3 SRNIDDLKTMLPCEYEEWRERGDDFRRTLTHAIMRHLETPEHWQVNAEYRTEFGGLFPVQCRFTPPD-GQWHLCVCSPGE 81  Butt...
ANG83402                  4 ELTLNVLHTMNAQEYEDIRAAGSDARRELTHAVMRELDAPDNWTMNGEYGSEFGGFFPVQVRFTPAH-ERFHLALCSPGD 82  Esch...
WP_004152657              4 VLNLDVLKTMSTEELEDYRNAGEDFRRELSHAVMRDLTVPDGWAVNAEYRAEFGGFFPVQLRFSPSH-DHFDVAVCSPGD 82  Ente...
PRJNA231221:MC50_027440   4 IITTDVLKTMFAGELEDYRAAGEDFRRELTHAVMRDLSCPESWDVNGEYKSEFGGFFPVQIRFSPSH-GHFDVAVCSPGE 82  Raou...
wugsc:KPN_pKPN3p05986     4 LLTLDVLKTMSSDELEDYRAAGEDFRRELSHAVMRDLTSPSGWSVNAEYRCEFGGFFPVQIRFTPPH-GHFDVAVCSSGE 82  Kleb...
KMV34099                  2 KFSLSQINTMIPSEFEQLREQGEEYRLDLSNSVTALLPVPQGWQVNAEYRSEFGGLFPVQCRFTPDG-EALALCVCSPGE 80  Fran...
WP_004966256              4 TFNLEILTAMSADELEQYRDRGREYRVMLNCAVLSQLAVPEGWRVVAEEGCEFCGCVPVVCRISPAGdEATALYLCSAGA 83  Serr...
PRJNA374633:B1H58_20515  39 SVTLQRLYAFSPGDFEAYSARGEEFRRRLCGAVLHALPLSDSWLTDCECREEWGGVFPVHLRLTHRKnRHVTLDILSPGN 118 Pant...
3NCT_A                   83 VSQVWVLVLVNAGGEPFAVVQVQRRFASEAVSHSLALAASLDTQGYSVNDIIHILXAEG 141
KFC76646                 82 ISPAWSVVLLSSCGQCVRLLMTTLVFEPQDINVLLQQTAALARMRCSATSVAEMLTQEE 140 Buttiauxella agrestis ATC...
ANG83402                 83 VSQVWVLVLVNAGGEPFAVVQVQRRFAPEAVSHSLALAASLDTQGYSVNDIIHILMAEG 141 Escherichia coli O157:H7
WP_004152657             83 LSPVWIIVFITRGGQPFSVVCSMARYNPERINHALSLIARLDEDGYSFASIINTLKQEG 141 Enterobacterales
PRJNA231221:MC50_027440  83 LSTRWMVVFVTRGGQPFSVVRSMETFNPELISHTLALIACLDTDGYSFASIISTLAQEG 141 Raoultella planticola
wugsc:KPN_pKPN3p05986    83 LNPRWIVVFVTRDGQPFSVVRVMDAFNPELITHTLDLIECLDAGGYSFASIISTLSQEG 141 Klebsiella pneumoniae sub...
KMV34099                 81 VSPVWLVVLLGADGTLVRVLHQSESLEPGAIGELLEKVAGMHRFNCT-AGTVAKLLAQG 138 Franconibacter pulveris
WP_004966256             84 EVPNWSISLPFDGGRSLAWLYLDERYTPATVNRVLHTVAGYYRLGFWRPEKLAVALRMG 142 Serratia odorifera
PRJNA374633:B1H58_20515 119 ESPFWHGLIWINPDHTGLYVLNTERFEPETIGRVLTRIEKMVSAGITPAEIVAVLGRKG 177 Pantoea alhagi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap