Conserved Protein Domain Family
FlbD

?
pfam06289: FlbD 
Flagellar protein (FlbD)
This family consists of several bacterial FlbD flagellar proteins. The exact function of this family is unknown.
Statistics
?
PSSM-Id: 399352
Aligned: 161 rows
Threshold Bit Score: 62.808
Threshold Setting Gi: 504250440
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q67PC3                1 MIKLRRFRSkgGEFVVNADLIETVEATPDTVVTLTTGHKLIVEESVDEVIRKVVEFKRAC 60  Symbiobacterium thermophilum
goetting:CLSA_c39270 13 MIRVTGMDK--KRFMLNADHIEKIEEMPETIITLTNGKKYIVLESIEDVRNSVLEYKHKI 70  Clostridium saccharobutylicu...
CDB14775              1 MIDLTAMNN--KEFTLNADHIEKIEEVPETLITLTNGKKYIVLETIHEVKDKVIRYKNRI 58  Clostridium sp. CAG:221
WP_011721988          1 MIKLKGLNS--KELYLNEDNIEKIEEVPETLITLSNGKKYIVLETTKDVIDKIIEFKRKI 58  Clostridium novyi
Q97H60                1 MINLTGMNG--KELILNDEKIEKIEEVPETVITLINGNKYIVEESIDEVINKIIEFKKKI 58  Clostridium acetobutylicum
jgi:Clopa_2928        1 MIKLTGMNH--KEIVINSDNIEKIEEVPETVITLMNGNKYLVEETADEVIDKIILFKKRI 58  Clostridium pasteurianum BC1
WP_012101542          1 MIKLTGLDE--KEFVINSDHIEKLIEIPQSVITLVNGNKYIVKESNDEIIEKIIEYKRKI 58  Clostridium kluyveri
jgi:CAETHG_3121       1 MIRLTGLDN--KEFIINADAIEKLEAIPESLITLTNGKKYLVKESNEEIVEKVIKYKRKI 58  Clostridium autoethanogenum ...
Q18CZ3                1 MIRVTDLNG--RKYILNSDLIVRIDSVPESRILLTTGEKNLVKESVDEIVDKVIKYKRKI 58  Clostridioides difficile 630
Q2RKE1                1 MIKVTTLDK--REIILNAELIERIESVPETVITLTSGKKILVTQTAEEIMERVIAYRRLI 58  Moorella thermoacetica ATCC ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap