Conserved Protein Domain Family
DUF1033

?
pfam06279: DUF1033 
Protein of unknown function (DUF1033)
This family consists of several hypothetical bacterial proteins. Many of the sequences in this family are annotated as putative DNA binding proteins but the function of this family is unknown.
Statistics
?
PSSM-Id: 399347
Aligned: 14 rows
Threshold Bit Score: 155.967
Threshold Setting Gi: 122641508
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013773768   1 MYQVIIMFGDNEPWWFFADWQQDIIEEKQFDCLEKAENYYRKKWQEFSLSYTYINTKPNYLAAFWRDEEKRWCEECNENL 80  Melissococcus p...
WP_014025308   1 MYRVITMSGYDEPWWFFEDWQKDIQSVDEYEDFYQALKKYKSEWLKMAKSYKEFKSQDDLLAAFWRSGDEIWCEECAGYL 80  Lactococcus gar...
Q9CEJ2         1 MYRVVTMYGTDEPWWFFDGWKEDIVSVDEFDDFYKALKYYKKEWFEMAENYKEFTSKSGLQTAFWKNGDEEWCEDCVGYL 80  Lactococcus lac...
Q8DS48         1 MYQVIRMYGAMEPWWFLDDWKEDITKVLEFDNYHEALQCYQKEWAKLRRRYSDFNSHGDIMTAFWNKQDQHWCEECGDYV 80  Streptococcus m...
Q8DN85         3 MYRVIEMYGDFEPWWFLEGWEEDIVASRKFDQYYDALKYYKTCWFRLEQESPLYKSRSDLMTIFWDPEDQRWCDECDEYL 82  Streptococcus p...
Q9A1U0         1 MYQVIKMYGDWEPWWFIDGWQDDIIDEQQFSDWQEALDYFNQEWQRMKAIFPSYHSQKNLLATFWEKEDKRWCEDCDEDL 80  Streptococcus p...
CAR40527      23 MYQVIKMYGDWEPWWFIEGWQNDIVDEKEFDQWDEALAFYKQEWQHMKDDFPSYHSQKNLLATFWRTTDKRWCEDCGDDL 102 Streptococcus u...
Q8E237         1 MYQVVKMFGDWEPWWFIEGWEEDITEIAEYDTLSEALLYFQEEWDRGQEKWPYFQSKSSLLATFWSIKEKRWCEECDEYL 80  Streptococcus a...
EQC79319       1 MYQVIVMYGDNEPWWFFEGWQADIQEAFTFASFAEAQSFYEEKWHEIRKEYSYINAKTNFMTAFWNEDEERWCEECDDYL 80  Enterococcus sp...
Q3Y2F4         1 MYQVITMFGDNEPWWFFEDWEEDIEEEETFESFEEARQAYEKQWNEIHQNYEYINAKSNFLSAFWNDGDERWCEECDDDL 80  Enterococcus fa...
WP_013773768  81 QQYRGLALLgNNYKPVTFNNKYEKLNISNHIEKVKC-C 117 Melissococcus plutonius
WP_014025308  81 QRYQSLMLL-EDWHVLPVEKKRWAYGKSSGDLPPKV-C 116 Lactococcus garvieae
Q9CEJ2        81 QRYHSIALL-EDWHAIPLEKKRSGYSKKSGELPERF-C 116 Lactococcus lactis subsp. lactis
Q8DS48        81 QRYHSLALL-TDWQETPSSWFRPTFTKQNDTPFRSK-C 116 Streptococcus mutans
Q8DN85        83 QQYHSLALL-QDEQVIPDEKLRSGYEKQTSQERNRS-C 118 Streptococcus pneumoniae R6
Q9A1U0        81 QQFHSLLLL-KNKDIVPSNNYIPEFEQRNDSPQVAYlC 117 Streptococcus pyogenes serotype M1
CAR40527     103 QQFHSILLL-KDRDIIPSDQYVIAFEQRNDTPAAPYmC 139 Streptococcus uberis 0140J
Q8E237        81 QQYHSLMLL-KEWQEIPKEESIERFEVFNKIAelpsac 117 Streptococcus agalactiae serogroup V
EQC79319      81 QQYIGLALL-KEYQQVVDESRKDFYETTNSSGKAKR-C 116 Enterococcus sp. HSIEG1
Q3Y2F4        81 QQYKGLALL-KNHQPITVESRKEFYETTNSSGKTKR-C 116 Enterococcus faecium DO
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap