2KL5


Conserved Protein Domain Family
DUF1027

?
pfam06265: DUF1027 
Protein of unknown function (DUF1027)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399341
Aligned: 52 rows
Threshold Bit Score: 100.283
Threshold Setting Gi: 524720146
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KL5_A          15 IQNAEFELVHNFKDGFNEEAFKARYSD-ILNKYDYIVGDWGYGQLRLKGFFDDQNQKATFETKISTLDEYIYEYCNFGCA 93 
tum:LSA_08730   33 INGHLYNLIVNKNDGFELGQFENTFNP-IFTHFDYIVGDIGYGQLRLKGFYDDQ-RNVESDLKKSSIQDYLIDYCNFGSS 110 Lactobacillus...
WP_014215244    30 INGHLYEILQNYREAFDVEQLADRFVN-LFSRYDYIVGDVESNQLRLKGFYKDQ-LEVRNELKISSFQDYLYEVCGFGSP 107 Pediococcus c...
Q03EV3          30 INDHEYRLEVNYREAFDEELLAERFVG-LFSRYDFLVGDIGSGQLRLKGFYADD-MLAPSEMKISRVQDYLNEYCGFGCP 107 Pediococcus p...
Q74KT0          28 INGREYEIIANVKDALDIEMLKEKYDP-YLDQYDYLVGDVSSEHLRLKGFYDEN-DRVAIDKKANAIVDYLEEYCNPGSA 105 Lactobacillus...
Q1G963          37 INQREYRLLVNQRDALDREVLKQKYDP-YLDQYDYLVGDVSSDHLRLRGFYNDY-VKTSIDRKKSTIVDYLTEYCNPGAP 114 Lactobacillus...
Q5FLU8          59 INDQLYSVIVNERNALDIETLKKKYDP-YLDQYDYLVGDVSSEHLRLKGFYKDA-ARTSIDKKELAIVDYITEYCNPGSP 136 Lactobacillus...
Q03WK6          32 IDRLTLEIVEDFKDAFDEDKLAIRYTP-LLAQYDYIVGDISAEQLRLKGFYNNN-KAVNNHDKIQSLQDYLYEYVNFGAP 109 Leuconostoc m...
WKK:WKK_04875   34 INERAYKLVANYRDAYQDDLMAERFST-FLEKYDYLVGDIAADQLRIHGFYKDGKPGVSRMDQISALQDYIYEFMNFGAP 112 Weissella kor...
ripcm:ACL_1364   7 VG--NFELLKNYRDAFDIVKFQERYVDvAFDRYTYIVGDIASDKLRLRGFSQDP----KGTNGYKKIPDYINESCNHNCP 80  Acholeplasma ...
2KL5_A          94 YFVLK 98 
tum:LSA_08730  111 YFVLH 115 Lactobacillus sanfranciscensis TMW 1.1304
WP_014215244   108 YFVLQ 112 Pediococcus claussenii
Q03EV3         108 YFILR 112 Pediococcus pentosaceus ATCC 25745
Q74KT0         106 YFILR 110 Lactobacillus johnsonii
Q1G963         115 YFILE 119 Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 = JCM 1002
Q5FLU8         137 YFVLE 141 Lactobacillus acidophilus
Q03WK6         110 YFVLE 114 Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
WKK:WKK_04875  113 YFVLE 117 Weissella koreensis KACC 15510
ripcm:ACL_1364  81 FFVLK 85  Acholeplasma laidlawii PG-8A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap