4YYC


Conserved Protein Domain Family
MTTB

?
pfam06253: MTTB 
Trimethylamine methyltransferase (MTTB)
This family consists of several trimethylamine methyltransferase (MTTB) (EC:2.1.1.-) proteins from numerous Rhizobium and Methanosarcina species.
Statistics
?
PSSM-Id: 399337
Aligned: 25 rows
Threshold Bit Score: 552.639
Threshold Setting Gi: 81348494
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4YYC_A                     32 RTGGGPGPS-LPyiqRRIREYEVLDEEGLQLIERNADVVLEEIGIEFRDDaEALDLWKAAGADV--RGQRVHFPKGLCRE 108
dbos:SAR116_0785           22 RKLHVPSM--LPtleSRLPLTEPMDEDQIARIDDASMSILEDVGVVFRDP-VALDDWRSAGARV--EGDLVKFDRAHIRS 96  Ca...
vbi:Arad_3336              35 KPSGSK----YLnlvNNLARTELLSPETLDDIHEASLTILEEIGMDIILP-EARERMKAAGADVtpGTERVRFDRGMIME 109 Ag...
DSMZRoselon:roselon_00032  22 AAGPAIAQTpWRiplNTDRPTEPLDEAGIAALHSGAMRILSEIGIEFLND-EALGHLRAAGCRI--EGQTARFDPDFVMD 98  Ro...
Q1GEL3                     21 RGAATLEQMpWKppvNIDRPVEPLTAEGIAAIHDGAMRILEEIGVEFLND-EALEIFKEAGLKV--DGALVRMDREFVME 97  Ru...
WP_012179478               22 IRAHAIEQLpFHvprNPDAPTEPLAPEGVAAIHDTAMRVLEEIGIAFLNA-EALEIFREAGCHV--TGELVRMDRHFVLE 98  Di...
Q92YQ8                     15 RGGDGISQLpWQevvNTYAPMQLLDEERIEALHRNSMRILSEIGIRVMSE-KAMALFEKAGAIVdrENLMIRIDESIVEA 93  Si...
Q5LVY0                     15 PASARKVD--YRnlrNPFPPMAAFSEDRIEALHEASLSVLEELGIKVLHP-GARDLYRQGGARI--DGEMVHIGREMVEA 89  Ru...
Q16AK7                     20 AAPERNVN--YRnlrNPFPPMEVFSSDQIAAMHETSLRTLEELGIKVLLP-EAVEVLRKGGARV--VDQMVYLGRDMIDA 94  Ro...
Q28SB5                     12 RASARVTQ--YGqlrNPFPPMNVFPADRIEAMHDAGLDILERLGIKVLLP-EARAIFATAGAMV--KDDMVYIGRDIVEA 86  Ja...
4YYC_A                    109 LLKTAPKDFTWHARNPERNAQIGGKATVFAPVYGPPFVRDLDGN-RRYATIEDFRNFVKLAYXAPSXHSSGGTVCEPVDI 187
dbos:SAR116_0785           97 LISSIPETITLHARNPENTIGLGGRKSMFIPMTGAPYLRDLDDD-RRLPTLNDLGMFHKLAHMSPALHSSAHHIVEPMDH 175 Ca...
vbi:Arad_3336             110 LITSVPSTFTLHARNPLRNVEIGGNNLIFAQVASAPFVADREGG-RRAGNREDFRKLIKLAQSYDVIHTTGGYPVEPIDI 188 Ag...
DSMZRoselon:roselon_00032  99 MVGKAPAQFTITPRNPDRSVTIGGRHMTFVNVSSPPNAWDLERG-KRPGDFATFREFMKLTQYFNCIHIAGGYPVEPIDV 177 Ro...
Q1GEL3                     98 MVGKVPSEFTLTPRNPERAIRIGGNSIVFGNVSSPPNYWDMDLNkKVPGTREHCQNLLKLTQYFNCIHFAGGYPVEPVDL 177 Ru...
WP_012179478               99 MLSRAPAQFTLTPRNPDREITIGGQHMVFVNVSSPPNYWDMETG-KTPGTRAQCRNLLKLCQYFNCIHVVGGYPVEPVDV 177 Di...
Q92YQ8                     94 ALATTPSSFTLTSRNPEKRLTIGGNTIAFGLVAGPPNVHDRVNG-RRQGNLADYQNFTRLAHHFNAIHILGNQVCAPMEL 172 Si...
Q5LVY0                     90 ALASAPKSIRMRGAVPDRDVVLELGRMAFQPGAGCPHATDLARG-RRPGTIADFRELVQITQSFDVLHMVP-PLVEAQDV 167 Ru...
Q16AK7                     95 ALATAPRSITGRAGARDRDILLELGSLVFQPGAGAPHATDLARG-RRPGSARDFREYTTLCHHFDVFQMMS-PSVEPQDV 172 Ro...
Q28SB5                     87 SLASAPRRIEGRAGAPERDVVLELGSLVFQPGAGAPHATDEVRG-RRPGCARDFKELIQLTNHFDVFHMLP-PLVEPQDI 164 Ja...
4YYC_A                    188 AVNKRHLDXVYSHIRYSDKPFXGSVTAPERAEDTVAXAKILFGDDFVE--NNAVTLNLINANSPXVFDETXLGAAKVYAR 265
dbos:SAR116_0785          176 PVPHRHLQITYSSMKYSDKTFMGMTTSGKNGEDVMDMCDILFGAGYLE--DHAVVVGNINGNSPLVWDETMLGAMRAFVR 253 Ca...
vbi:Arad_3336             189 HASVRHLDCLSDIVKLTDKAFHCYSLGKQRNLDSIEIARIGRGISMEQmeREPSLFTIINSSSPLRLDGPMLQGIIEMSS 268 Ag...
DSMZRoselon:roselon_00032 178 HASVRHLDCLFEKLTLTDKVAHAYSLGPERVEDVMEMVRIAGGLTHDEfdAAPRMYTNINSVSPLKHDWPMLDGAMRLAR 257 Ro...
Q1GEL3                    178 HASIRHLDVLYDKLTLTDKVMHAYSLGKERVEDVMEMVRIAGGLSHEEfdSQPHMYTNINSTSPLKHDEPMIDGALRLVR 257 Ru...
WP_012179478              178 HASVRHLDVLFDKLTLTDKVAHAYSLGKERVEDVMEMVRIAGGLTEAEfaARPHMYTNINSTSPLKHDQPMIDGALRCIR 257 Di...
Q92YQ8                    173 PANSRHLDTYKANLALSDLCFHCTAIGRGRAVDGINMMAIARGISVEEmsQSPGVITIISVNSPRLFDDAMADGLIAMAE 252 Si...
Q5LVY0                    168 PMHLRHMAMTEVELTQSDKVPFLYSRGTPQVMDGFEMIRDFRGLSDAEfrAQSWCYTIINTNSPRTIDMPMAQGLIDFAR 247 Ru...
Q16AK7                    173 PTHLRHYFTTEVQLTRTDKFPFVFARGTPQAMDCFEMLRDFRGLSDAEfaDSPHCYTIINTNSPRTLDIPMAQGLIDFAR 252 Ro...
Q28SB5                    165 ATNIRHYFTLECQLTESNKFPFIFSRGTPQVTESFEMLRDFRGLSDAEfeAEPRCYTIINTNSPRTLDVPMAQGLIDFAR 244 Ja...
4YYC_A                    266 HNQACVVSPFILSGAXSPVTVAGTLTQILAEVLAGAAFTQLIRKGAPVLFGTFAASISXQSGAPTFGTPEPSLVSYGAAQ 345
dbos:SAR116_0785          254 RNQPVLCSPFVLGGANTPASTVPAVAQLNAEALSALAYTQVVRKGAPAIYGHYLSTVSMRSGAPMAGTPEISLMNFMIGQ 333 Ca...
vbi:Arad_3336             269 RGQVVVITPFTLAGAMAPVTIAGALVQQNAEALCGIAFSQMVRKGAPVMYGGFTSNVDMKTGAPAFGTPEYMKAVIAGGQ 348 Ag...
DSMZRoselon:roselon_00032 258 RGQPVVVTPFTLAGAMAPVTLAGAVALSLAEGLAAIALLQWIAPGCPVAIGTFTSNVDMKSGAPAFGTPEYMRATQMTGQ 337 Ro...
Q1GEL3                    258 RGQPVIVSPFTLAGAMAPVTMAGAVAQSLAEALCAIALFQYVRPGTPCAIGTFTSNVDMKSGAPAFGTPEYMRATQMTGQ 337 Ru...
WP_012179478              258 RGQALIVTPFTLAGAMAPVTLAGAVAQSVAEALAAIALAQYVRPGCPVALGTFTSNVDMKSGAPAFGTPEYMRATQMTGQ 337 Di...
Q92YQ8                    253 HGQPVTITPFTLMGAMTPVTLAAALCQQNAEALFGVTLAQLVNPGTPVMYGAFTSNVDMRSGAPAFGTPENAKANIIAGQ 332 Si...
Q5LVY0                    248 HGQMAIITPFTLMGAMAPVTVAGAMTLSHAEALAAITLSQLAQPGAPVCYGTFTSNVDMKSGAPAFGTPEHFTASLVAGQ 327 Ru...
Q16AK7                    253 NGQLSIVTPFTLMGAMAPITVAGAITLSHAEALAAITLTQLVKPGAPVCYGTFTSNVDMKSGAPAFGTSAHFQASLAAGQ 332 Ro...
Q28SB5                    245 MGQISIVTPFTLMGAMAPITVAGAITLSHAEALAAITLTQLTNPGAPVCYGTFTSNVDMKSGAPAFGTPSHFQASLAAGQ 324 Ja...
4YYC_A                    346 LARRLGLPFRTGGSlCGSKVPDAQAAHESANTLNXTLLAGTNFVLHAAGWLEGGLVSSYEKFXIDQDQLGXXQKXAEG-- 423
dbos:SAR116_0785          334 MARFYGVPWRTSNTlGGAKTLDAQAGYESATTLMAVLMAGANYIWHSAGWNEAGMHCSVAKFMVDAEQCAMGYRMAEG-- 411 Ca...
vbi:Arad_3336             349 LARRYGIPYRTSNT-NASNTLDAQAAYESALSLWALTQGGGNFVLHAAGWSEGGLTACFEKFILDVDMLQMVAEFLTP-- 425 Ag...
DSMZRoselon:roselon_00032 338 MARHYGLPMRASGV-CAANVPDGQAMWETGNSLWAAVQSGANMVYHAAGWLEGGLIASPEKFVMDCELLQQIQRYFEPal 416 Ro...
Q1GEL3                    338 MARFYGLPMRSSGV-CAANVPDGQAMWETSNSLWAAVQSGTNMVYHAAGWLEGGLIASPEKFIMDCEVLQMIQRYMDPvi 416 Ru...
WP_012179478              338 MARFYGLPMRASGV-CAANVPDGQAMWETSNSLWSAVQSGANMVYHAAGWLEGGLIASPEKFIMDCEMLQQIARYFSPdl 416 Di...
Q92YQ8                    333 LARRYKLPYRTSNA-NASNAVDLQAAYETEMATWGAVLGGANLIYHAAGWLEGGLTASYEKLVLDVEILQNMMGFLEP-- 409 Si...
Q5LVY0                    328 LARRIGLPWRCAGG-SAANINDAQAANETQFGLWGCLLAGATVTIHAAGWLEGGLTVSYEKIITDLEVLQMVAELCAG-- 404 Ru...
Q16AK7                    333 LARFTGLPWRSAAG-SASNINDVQAANENQMGLWGSLMGGATVIIHAAGWLEGGLSVSYEKIITDFEVLNMIAELCAG-- 409 Ro...
Q28SB5                    325 LARHIGLPWRSAAG-SAANLNDVQAANENQFGLWGCLMAGATVVIHSAGWLEGGLSISYEKLITDAEVLNMVAELCAG-- 401 Ja...
4YYC_A                    424 VDLSEDAQALD-AIREVGPGSHYLGCAHTQANFQSAFYRSPLADNNSFEQWEIEGEKRIEQRANALARSWLEHYEAPYLD 502
dbos:SAR116_0785          412 LRWDDFDEALS-AIRDIGPGGHYLGHAHTLENFERAFFMPSLFDNNSFEQWQAEGAQDVTARALSMARQMLNEYEEPKLD 490 Ca...
vbi:Arad_3336             426 LDVSQDALALD-AVRDVGPGGHYFGTAHTLARYETAFYSPILSDWRNYETWTEAGRPTTYDHANRIFKETLARYERPPLD 504 Ag...
DSMZRoselon:roselon_00032 417 TATAEDDLAID-AIAEVGPGGHFFGCAHTQARYQNAFYQPFASDWRNFEAWAGDGGVWTVERAHRIYKRILAEFEAPPMD 495 Ro...
Q1GEL3                    417 NATGPEEIALD-AIREVGNDGHFFGIQHTQDRYATAFYQPFLSDWHNYEAWEAAGGTWTAQRANGLFKQIINEFEAPTLD 495 Ru...
WP_012179478              417 TATTPDDLAFD-AMAEVGTSGHFFGIQHTQDRYETAFYQPFLSDWRNFEAWERDGATWTVARAHRIYKEILTEFTPPPMD 495 Di...
Q92YQ8                    410 MPFSEDDLGFD-AIRSVPAGGHFFGSEHTMARYETAFYQPMLSNWQNYGSWQEAGGRDALERATDIWQQALREYEEPVLD 488 Si...
Q5LVY0                    405 TPATDADIALD-ALREVPPMGHFFGAAHTMARYQTQFYEPLVGDWSNFGQWSERGAVDANHRATGIWRGIVDNFEPPPMD 483 Ru...
Q16AK7                    410 KQAGIDEIGFDtALSAVEPSGHFFAAPQTMARYNTEFYEPIVHDYANFGTWTERGAQDANQRATRVWQDILAADKRPEVD 489 Ro...
Q28SB5                    402 AQASDAEIGLD-AIEDTAPSGHFFATAQTMARYQTEFYEPIIHDYANFGTWTERGSKDASTRARDVWQGILADPKSPTVN 480 Ja...
4YYC_A                    503 PAIDEALKEFIAKRKDSXP 521
dbos:SAR116_0785          491 VAINDALLDYIARREREIP 509 Candidatus Puniceispirillum marinum IMCC1322
vbi:Arad_3336             505 SAIEEELDAFVARRKEEGG 523 Agrobacterium radiobacter K84
DSMZRoselon:roselon_00032 496 AEIRDELADFVARRKAQGG 514 Roseibacterium elongatum DSM 19469
Q1GEL3                    496 EGIREELQAFVARRKEEGG 514 Ruegeria sp. TM1040
WP_012179478              496 PAIREELSDFVARRKAEGG 514 Dinoroseobacter shibae
Q92YQ8                    489 PAIREELDAYTIKRRAEIG 507 Sinorhizobium meliloti
Q5LVY0                    484 PDRVAALQDFIARRTAEGG 502 Ruegeria pomeroyi
Q16AK7                    490 GKRLENLQDFIAKRTAEGG 508 Roseobacter denitrificans OCh 114
Q28SB5                    481 GDRLSALQDDIARRTQAGG 499 Jannaschia sp. CCS1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap