3P42


Conserved Protein Domain Family
Caps_synth_GfcC

?
pfam06251: Caps_synth_GfcC 
Capsule biosynthesis GfcC
Many bacteria are covered in a layer of surface-associated polysaccharide called the capsule. These capsules can be divided into four groups depending upon the organisation of genes responsible for capsule assembly, the assembly pathway and regulation. This family plays a role in group 4 capsule biosynthesis. These proteins have a beta-grasp fold. Two beta-grasp domains, D2 and D3, are arranged in tandem. There is a C-terminal amphipathic helix which packs against D3. A helical hairpin insert in D2 binds to D3 and constrains its position, a conserved arginine residue at the end of this hairpin is essential for structural integrity.
Statistics
?
PSSM-Id: 399335
Aligned: 9 rows
Threshold Bit Score: 269.656
Threshold Setting Gi: 81758564
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3P42_A         2 AQGXVTIYLPGEq-QTLSVGPVENVAQLVTQPQ------------LRDRLWWPGALLTDSAAKAKALKDYQHVXAQLASW 68 
Q6D778        21 AQLTVKSPQETI--AVVKLDDGTRLEKFYEQVS------------WPQNINWQTAFISDFATTQKVRVQGDVLLQKLAEL 86  Pectobacterium ...
P75883        22 AQGTVTIYLPGEq-QTLSVGPVENVVQLVTQPQ------------LRDRLWWPGALLTDSAAKAKALKDYQHVMAQLASW 88  Escherichia col...
Q328Y3        20 AAGTVKVFSNGSs-EAKTLTGAEHLIDLVGQP-------------RLANSWWPGAVISEELATAAALRQQQALLTRLAEQ 85  Shigella dysent...
Q8ZKI2        20 ASGTVTVFTQGNs-EPKTLTDAERLLDLVGQP-------------RLATSWWPAAVIGEEQATVTARQQQQELLGRLAVL 85  Salmonella ente...
Q15QX9        18 CVTSANVTIKWNe-VDYTFDSTVRLTDVLSKLD------------LNTNIYWPSAALF-IPNDVTLERARRSSLSNLNIL 83  Pseudoalteromon...
Q7MPN4        34 IQQPTEVVLLNYg-LQLNYPQPVRLEQVLLDAQqqnrqqngspnaQALSFH-EGFQLFNLDKQAEADAQLQHVRQQLIEL 111 Vibrio vulnific...
Q5E8J3        23 STQAVSVTLPNQn-LVLNYSQPVRLEQVILDAN------------AQVNFYSLGAALSDNQLQKDIDNLRNNSIEQLSSL 89  Aliivibrio fisc...
WP_011706676  19 ADATISIWWKGKpvKDLYYAKQITLSSALSDPAi-----------LSYDSYWPVGQISTPARQQELEHQRQVLLADLTVL 87  Aeromonas hydro...
3P42_A        69 EA-----EADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPL-VGDYTLYTVQRPVTITLLGAV--S--- 137
Q6D778        87 ETrw-rnSGDGDLAISAWLLRKAINPINVAGRIRTNLDPDRVRVYSENNRPL-VGEYALYVAPHDDKLALIGLVntSadv 164 Pectobacterium ...
P75883        89 EA-----EADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPL-VGDYTLYTVQRPVTITLLGAV--S--- 157 Escherichia col...
Q328Y3        86 GA-----DSSADDAAAINALRQQIQVLKVTGRQKINLDPDIVRVAERANPPL-QGNYTLWVGPPPSTVTLFGLI--S--- 154 Shigella dysent...
Q8ZKI2        86 SA-----EEDGDAAAAINTLRRQIQAVKVTGRQFVNLDPDVVRVSERGNPPL-QGHYMLWVGPQPTQVTLFGLI--S--- 154 Salmonella ente...
Q15QX9        84 AShl--pSDTHEQKSVFTNLINELEHWHLANRLSVKIDYDLARISEAHNPQFdNGYYVVSLHERQESVEIIGAV--T--- 156 Pseudoalteromon...
Q7MPN4       112 AK-------DEDYRQASQLLLTLLEKHQYGYRENINLDIDAVRLKADLNPAL-PGHYALKQASRENKVLLLGLI------ 177 Vibrio vulnific...
Q5E8J3        90 SRetslfSANNEFKRSATQIISQLEHHTFVGRIFSSLDLDLIRINEKLNPIL-NADYQLFVHPRPTSVSFFGAIdsE--- 165 Aliivibrio fisc...
WP_011706676  88 SKmw-sdMGEPSLASATLQLLQQLQQLELTGRFDVSVDPDVNQARAGVDAPIlKGHYQLYLAPRHPEVQIAGLV--K--- 161 Aeromonas hydro...
3P42_A       138 ----GAGQLPWLAGRSVTDYLQDHPRLAGADKNNVXVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYAD 213
Q6D778       165 geleTSGNVVLRAGWSVENYLVGRRLLAGADNSYGYLIGGNGQWRKVPLALWNRQHIEPAAGETIFIGFNPSVLPQDMSS 244 Pectobacterium ...
P75883       158 ----GAGQLPWQAGRSVTDYLQDHPRLAGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYAD 233 Escherichia col...
Q328Y3       155 ----RPGNQPFTPGRDVASYLSGQSLLSGADRSYAWVVYPDGRTQKAPVAYWNKRHVEPMPGSIIYVGLADSVWSETPDA 230 Shigella dysent...
Q8ZKI2       155 ----QPGSQPFVPGRDVASYLEDQRLLSGADRSYAWVVYPDGRSQKAPVAYWNKRHIEPMPGSIIFVGFADSLWRGTPEA 230 Salmonella ente...
Q15QX9       157 ----NTVETKHLPHTDVSEYLNSANIASFANRDTVIIIQADGRIIEAPTAYWNRQHQEVMPGSIIYVPFKESLFTPQYKE 232 Pseudoalteromon...
Q7MPN4       178 ----DQKTVPFSADLDVADYIATSTLNNNGNKSEAWVIAPNGNSSKVGYSYWNNQHMSVLPGSTIFIGF--NSSNNELQA 251 Vibrio vulnific...
Q5E8J3       166 ----SSISVPFIEHASIDDYLDSLPLSSTADTSTIYVIQPDGVVQTTEFSVWQNKPAYLAPGASVYIPL--GGLPSDFSS 239 Aliivibrio fisc...
WP_011706676 162 ----QIGGAPLLPGAGLREYWKRKDILEGGDPAGVYLVSPSGKYDWFPVAIWNERHVEAMPGATLFVGFSPDVLPKQYQN 237 Aeromonas hydro...
3P42_A       214 LNDQIVSVLTQRVP 227
Q6D778       245 LNEQLADYLANRIP 258 Pectobacterium atrosepticum
P75883       234 LNDQIVSVLTQRVP 247 Escherichia coli K-12
Q328Y3       231 LNADILQTLTQRIP 244 Shigella dysenteriae Sd197
Q8ZKI2       231 INADILHTLTQRIP 244 Salmonella enterica subsp. enterica serovar Typhimurium
Q15QX9       233 LNQLIVTLAKNRLH 246 Pseudoalteromonas atlantica T6c
Q7MPN4       252 LESDIVKLL-GMIK 264 Vibrio vulnificus YJ016
Q5E8J3       240 LNTSIVQLLRNK-A 252 Aliivibrio fischeri ES114
WP_011706676 238 LNERILTLFANRMP 251 Aeromonas hydrophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap