Conserved Protein Domain Family
DUF1016

?
pfam06250: DUF1016 
Protein of unknown function (DUF1016)
Family of uncharacterized proteins found in viruses, archaea and bacteria.
Statistics
?
PSSM-Id: 399334
Aligned: 35 rows
Threshold Bit Score: 202.759
Threshold Setting Gi: 409170572
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
bsuwp:MCON_0078        194 AQIFKDPYLFDFLGTAD--PRREREVEKGLIDHIQRFLLELGEGFAFVGRQVHLEFATKDYYLDLLFYHLKLRSYVVVEL 271 Metha...
WP_014263547           191 EEAIKDPFVLEFLDLKD--EYSESDLEEALIRHLTDFLLELGDDFAFLGRQRRLRIDDAWFRIDLLFFHRRLRCLVIVDL 268 Granu...
EFV27968               179 KEIIRDPYILEFLGIPQgeHFLETDLEQLLISRLQRLMLELGKGFAFVARQKRISFDDKHFYIDLVFYNYLARCFVLIDL 258 Bacte...
WP_014775806           175 LEFIKNPMVAEFLGLASnmDFTESRLESAILTHLQKFIMEMGKGYAFVARQQHISTDAGDYFIDLVFYNYILKCFLLIDL 254 Alist...
jgi:Pnap_0993          183 REFVRDSVLLEFLGLPGtgRLLESDLEQGLMDKLQAFLLELGKGFAFVARQQRISTESKDFYIDLVFYNYLLKCFVLFDL 262 Polar...
WP_012877101           177 TEIIKDPMVLEFLGLERrpEYYERDLEGALLTHLQSFLLELGNGFSFVARQRRIVLEDDEFFVDLVLYNRLLRCFVLVEL 256 Xylan...
CDC46900               203 GDIVKDPYVLEFLGLDEkiDFSETELETRLINHLQEFLLELGTGFAFVARQKRFTFEEDHFRVDLVFYNRLLQCFVLFDL 282 Firmi...
CDE40401               182 QDIIRDPFVLEFAGLPKqkRYKESDLEKALKDHMEQFLLEMGRGFAFVGRQYSMQIGSRQFKVDLVFYHCILKCYVLIDL 261 Prevo...
PRJNA61269:NIASO_19345 172 TEAIKDPYVLDFLKIPQshRMTEKGLEQKIIDNLQLFLLELGKGFAFVARQYKISLRNKHYYIDLVFYHRILKCFVLIDL 251 Niabe...
Q3AT24                 175 ADLLRDSFVFEFLKIPEssEMAELDLESRLCDHLQPFLLELGKGFTFVGRQYRIPINNSNYRVDLVFYHRILRCFVLIDL 254 Chlor...
bsuwp:MCON_0078        272 KSVSFDPGFVGTLNMYLSAVDDLLRHPDDKPSIGLLLCRKGSRIEVEYALRGIQKPMGVAGWetKLVKTLpeELQSKLP 350 Methan...
WP_014263547           269 KAGRFNYADAGQMHLYLNYAREHWMKPDENPPVGLILCAEKGVAEAHYALDNLSNKVLAAEYqtILPDEK--LIAEELK 345 Granul...
EFV27968               259 KSGELTHQDLGQMQMYVNYYTRELMNPGDNPPVGIVLCAEKNDAVVRYTLPEDEKQVFAAQYmtYLPTQE--ELQTLLQ 335 Bacter...
WP_014775806           255 KTTQISHQDVGQMDMYVRMYDELKRTDGDNPTIGLILCTETSRDIARYSVLHENPQLFAAKYltYLPKEE--ELREEIE 331 Alistipes
jgi:Pnap_0993          263 KTGELAHQDIGQMDMYVRMYDELKTGPDDNPTVGIILCSQKDASVVRYSVLNGSEQLFASRYklVLPSEE--ELRRELD 339 Polaro...
WP_012877101           257 KTRKVTHADLGQLQMYVNYFDREEKLGDENPTVGILLCADKNDTVVRYSLPTDNTTILASRYqlYLPSEA--ELVSELR 333 Xylani...
CDC46900               283 KTEKLRHQDLGQMQMYVNYYDRYEKQDFENPTIGILMCPDKNDAMVELTLPENSN-IYASKYqlYLPDKK--LLQDKLK 358 Firmic...
CDE40401               262 KRAEIKHGDIGQMNLYLNYFKTEVCQPDDNPPIGIVLGARKDELLMEYALEGITNQLFVARYqlYLPKRE--ELQAQLD 338 Prevot...
PRJNA61269:NIASO_19345 252 KIRKVEHGDIGQMNLYLNYFKTEENVEGDNEPIGIILSAEKDEVLVEFATGGISNKIFVSKYqlYLPDKK--QLQKNVK 328 Niabel...
Q3AT24                 255 KINEVEHHDIGQMNLYLGYFAAEENTPDDNPPIGIILTRQKDELLVEYATYQMNSQLFVQKYqlYLPDRE--ELRREIE 331 Chloro...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap