Conserved Protein Domain Family
ECSIT

?
pfam06239: ECSIT 
Evolutionarily conserved signalling intermediate in Toll pathway
Activation of NF-kappaB as a consequence of signaling through the Toll and IL-1 receptors is a major element of innate immune responses. ECSIT plays an important role in signalling to NF-kappaB, functioning as the intermediate in the signaling pathways between TRAF-6 and MEKK-1.
Statistics
?
PSSM-Id: 399325
Aligned: 18 rows
Threshold Bit Score: 313.495
Threshold Setting Gi: 1084302766
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q17B53        25 KDTKGGPhhRPEEAEGDTENDHhqrkssetrvALRTPLFEHV--STKDKKTYIEMVRVFEGRSVHRRNHVEFIYAALKHM 102 yellow fever mo...
Q9QZH6        50 DEPWLVP--RPPEPQRKPIKVP----------AMHEDLFKPSgnRERDKASFLNAVRSFGAHNVRKRGHVDFIYLALRKM 117 house mouse
XP_002724302  50 SDLSLVP--SPPESQRRPVKVL----------EPHEELFKQApgGERDKASFVRAVQCFGQQDVRRRGHVDFIYLALRKM 117 rabbit
ELV14291      41 SELSLVS--RPPDPPRRPARAL----------APHEELFRQApgEERDKASFVRAVRSFEQHSVRKRGHVDFIYLALRKM 108 Chinese tree shrew
XP_005994181  62 SEPAPSa-eSKDQERGPRDKSL----------VTYDDLFKKAagDSRTKATFNRVVDTFCNKNVRRRGHVEFIYAALKKM 130 coelacanth
NP_001229867  61 RQNRTDIekLVEDETHHKDKTL----------VTHDDIFDRAagDSKTKVEFNRVVDVFKSKDIRRRGHVEFIYAALKKM 130 zebrafish
CAF92631      61 KTSVPAa-eLFNEDKTKNSSAL-----------AHVDLFDHVagEFKTKAMFNKAIDVYVKSDVRRRGHVEFIYAALKRM 128 spotted green p...
XP_023201534  55 SQPEHVr--FVNDDDTKKTKSL----------VTQEDLFEQVakESKTKATFNQVIDVFTKRDIRRRGHVEFIYAALKKM 122 southern platyfish
EDX11805      33 PKQNPNPnpRAQKPGTKNLPAL-------------RNPFTAA--QDRTKNSYLTMVEIFQERDVHRRNHVEFIYAALKNM 97  Drosophila simu...
XP_001607437  91 NQEKPKEesRSEDEKDDKRKGRssv----fakALVLHAFENA--RKKEKETFLECLRMYQNQPGIKQERVPFIYTALKYM 164 jewel wasp
Q17B53       103 EEFGVHKDLEVYKSLINVMPKGKFIPTNIFQAEFMHYPRQQQVIIDLLEQMEDNGVIPDYEMESMLVNVFGKKGHPVRKY 182 yellow fever mo...
Q9QZH6       118 PEFGVERDLSVYNLLLDVFPKEVFRPRNVIQRIFVHYPRQQECGVAVLEQMERHGVMPSAETEFLLIQIFGRKSYPMLKF 197 house mouse
XP_002724302 118 REFGVQRDLAVYNLLLDVFPKEVFRPRNVFQRMFVHYPRQQECGVAVLEQMEQHGVMPDTQTEFLLTQIFGRRSYPMLKL 197 rabbit
ELV14291     109 REFGVERDLAVYNLLLDIFPKEVFKPRNVIQRIFVHYPRQQECGIAVLHQMESHGVMPNKETEFLLVQIFGRRSYPMLKF 188 Chinese tree shrew
XP_005994181 131 PEFGVERDINIYNRILDVFPKEVFVPQNFIQRMFNHYPRQQECGVQVLEQMENYGIMPNKETKFLLVQIFGEKSHPVRKY 210 coelacanth
NP_001229867 131 PEFGVECDVTVYNKLLDVFPKEVFVPQNFIQRMFNHYPRQQECGVQVLEQMENYGVMPNIETKVLLVQIFGEKSHPIRKF 210 zebrafish
CAF92631     129 PEFGVERDLAVYNKLLDVFPKEVFVPRNFIQRMFNHYPRQQECGVQILEQMENYGIMPNVETKVLLVQIFGEKSHPMRKY 208 spotted green p...
XP_023201534 123 PEFGVERDLTVYNKLLDVFPKEVFVPRNFIQRMFNHYPRQQECGVQVLEQMESYGIMPNIETKVLLVQIFGEKSHPIRKY 202 southern platyfish
EDX11805      98 ADFGVERDLEVYKALINVMPKGKFIPTNMFQAEFMHYPKQQQCIIDLLEQMEDCGVMPDHEMEAMLLNVFGRQGHPLRKY 177 Drosophila simu...
XP_001607437 165 EEFGVHKDLSVYKQLIDIFPKQKMIPSNLFQGMFLYYPKEQYCATAVLEQMEDNGVIPDPEMELMLLNIFGRHGMPLEKY 244 jewel wasp
Q17B53       183 WRMMYWMPKFKNLSPWPLPNPVPDDSLDLAKMAVERMCSvDLLSQITLFDTENVPDAID-----HTWIVS 247 yellow fever mosquito
Q9QZH6       198 LRMKLWFTRFKNINPYPVPRDLPQDPLDLAKLGLRHMEP-DLSAKVTVYQMSLPSDSTGmedptQPHIVG 266 house mouse
XP_002724302 198 VRMKLWLTRFKNVNPFPVPLHLPPDPVDLAKLGLRHMEP-DLSARVTVYQMSLPSDPASpeepaQPHIVG 266 rabbit
ELV14291     189 LRMKLWLTRFKNINPFPVPHELPQDPVDLARLGLQHMEP-DLSARVTVYQMPLSSDSTGladptQPYIVG 257 Chinese tree shrew
XP_005994181 211 QRIMYWFPKFKHANPYPVPAVLPQDPLDLAKFSLQRIAA-DLDAKTTVFQMPATDISEDgaevkQPYVVG 279 coelacanth
NP_001229867 211 QRIMYWFPKFKHTNPYPVPHVLPSDPVDLAQFSLTRIAA-DLDAKITIYQYPSTDITETgeeitRPHIVG 279 zebrafish
CAF92631     209 QRILYWFPKFKHLNPFPVPQELPADPVDLARFSLTRIAD-DLDAEVTVYQVTSTDVSESgehvsLPHIVg 277 spotted green pufferfish
XP_023201534 203 QRIMYWFPKFKHVNPFPIPQPLPEDAVDLAVLSLTRIAN-DLDAKTTVYQLPFTDITESgeeisFPHIVG 271 southern platyfish
EDX11805     178 WRMMYWMPKFKNLSPWPLPDPVPDDTLEMAKLALERMCTvDLRSKITVFETSELKDAID-----DTWIVS 242 Drosophila simulans
XP_001607437 245 WKMMYWQPKFKNLNPWPVPQPIPTDLRELAWYAMNKISSiDVRSVVTDFNTEDVPDSID-----KTWIVS 309 jewel wasp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap