Conserved Protein Domain Family
DUF1011

?
pfam06237: DUF1011 
Protein of unknown function (DUF1011)
Family of uncharacterized eukaryotic proteins.
Statistics
?
PSSM-Id: 399324
Aligned: 71 rows
Threshold Bit Score: 79.9
Threshold Setting Gi: 555698170
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015790772 255 RIRYLLFLQALISALTNGVLPSLQSYSCAPYGTLAYNLAVKLAGLANPICAFLAFFWKSkINLKMITLLTCLGLCFSSYT 334 two-spotted spi...
XP_798894    298 AYWYIFILLGFVNALSNGILPSIQSYSCAPYSYNAYLLAATLGNVANPVACFVVMLFPQ-KSLILVGATAFCGTLISSYC 376 purple sea urchin
XP_798899    289 EYAILFVILAIANALSNSVLPSIQSFSCGAYGFNAYLLAATLCQVANPVACFIVLFFPH-TSLVLVAGTCLLGLLTGGYC 367 purple sea urchin
XP_011670528 383 KHIFLFIILTVISSLIYGALPSIQSYSAGGYGSHTYLLVTAFAEISVPIGFVLVMIRPT-TSILIVLLTCFTGILAGTYC 461 purple sea urchin
XP_780481    362 gHAFLFTTLTLISALTYGVLPSIQGYSSAAYGSNIYLLATTFAEISVPIGFFLVMIRPT-TSYPVVLLTSLCGVTAGGYC 440 purple sea urchin
EDV21803     356 RYIILLLTEGWAFCISNGVLPSIQPFSCLPYGLKTYHRTVASVAVTYPLSSVFAVLLFKyRSMTAVFYTSTLSRATGIFI 435 Trichoplax adha...
ESO01403     353 HLAFYLSSIVAINMATNGIIPATQSYTCLPYSNVVYTLTVRLSSVVGSLSSLSSMFIPK-PSIKVFFFMILTALSVVVFH 431 Helobdella robusta
EDO36685     265 QNVFLLVILAIVNGLSNGIIPAIQSYACIPYSYYIYHLTLTLSNIANPITCLMFPLLRV-KSIPVITFLCGVYCVMCTYI 343 starlet sea ane...
Q3LFN0       260 RLAFLLLTTALVNAQMNGIVTSVQSYATLVYSQNTYHYAVTLSNVISPLASYLQFFVKI-RSLPILAFLTLCSSLTTAVI 338 Caenorhabditis ...
NP_001317853  18 KFTFLLFTTALVNAQMNGIITSVQSYAALPYSQATYHFAVTLSNVVSPLSSFLPFFISV-RSIPVLAILTACSTAMTAFI 96  Caenorhabditis ...
XP_015790772 335 AVTAVLSPSPPFV 347 two-spotted spider mite
XP_798894    377 LATAALSPTPPLQ 389 purple sea urchin
XP_798899    368 MATALLSPTPPLQ 380 purple sea urchin
XP_011670528 462 MVVATLSPTPPLQ 474 purple sea urchin
XP_780481    441 IVTASLSPTPPLQ 453 purple sea urchin
EDV21803     436 ITSAVMSPYPPLH 448 Trichoplax adhaerens
ESO01403     432 VVIAVLSPTPPLV 444 Helobdella robusta
EDO36685     344 IIIASQSPDVLLR 356 starlet sea anemone
Q3LFN0       339 IYLAALSPNWIFN 351 Caenorhabditis elegans
NP_001317853  97 VYLAALSPNLIFN 109 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap