Conserved Protein Domain Family
GAGA_bind

?
pfam06217: GAGA_bind 
GAGA binding protein-like family
This family includes gbp a protein from Soybean that binds to GAGA element dinucleotide repeat DNA. It seems likely that the this domain mediates DNA binding. This putative domain contains several conserved cysteines and a histidine suggesting this may be a zinc-binding DNA interaction domain.
Statistics
?
PSSM-Id: 399313
Aligned: 30 rows
Threshold Bit Score: 319.317
Threshold Setting Gi: 565361237
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004985071   1 MDDDGSLG---IRNWG-FYET-----VKGNLGLQLMS-SVPpDRDtk------------pLLPNGGNFLqhhghhnap-- 56  foxtail millet
KQJ96172       1 MDDDGSLG---MRNWG-FFEPp----TRNNLGLQLMS-SMPaDRDtk------------qLLSSSP-FIhqhhhvhphap 58  stiff brome
XP_006661609   1 MDDDANMS---MRGWGsFFNS-----PARNLGLQLMS-SVPaDRDtk------------qLLSATP-FLqhhhh------ 52  malo sina
P0DH88         1 MDDDASMS---IR-WGgFFES-----PARNLGLQLMS-SVPaERDtk------------qLLSGSP-FLhhqhqqhv--- 54  Japanese rice
Q7XH85         1 MNDDASMSsmgLRGWGaFYEP-----PARNLGLQLMS-SVPaDRDtk------------hLLSATP-FLhhhqhqqyv-- 59  Japanese rice
XP_006347363   1 MDGNGGMN---IRNWS-YFEPtp-tvPKGHLGLQLMS-SMN-EkpphfrnihdnhhqqqqTHQPDHPTVmas-------- 65  potato
XP_006374225   5 MDEDNSLN---IRNWG-YYEPt---pVKGNLGLQLMSpTMP-Ek---------------pILGSRSPAImt--------- 52  black cottonwood
XP_003528994   1 MDGDNGLN---IRNWG-YYEPat--sFKSHLGLQLMS-SLP-Ek---------------pLIGGRNAVVla--------- 48  soybean
Q9SKD0         1 MDDDG------FRNWG-YYEPaaassfKGNLGLQLMS-TI--DRNtk------------pFLPGRESNLmig-------- 50  thale cress
CAN69256       1 MDDDGGLN---MRNWG-YYEPa----FKGHLNLQLMS-SVA-ERDtk------------pFLPGRDSPLmv--------- 49  wine grape
XP_004985071  57 hqhqhqhhtQHPHHPRGggggsgapsg------mpteppavhMDFVRnEAWLHP---SQhhhqhhhqhqhprqpkvlhhl 127 foxtail millet
KQJ96172      59 qhthhhphpHPHLHPRDgcggvssga--------pndapsvpMNFVHnEAWMHP---AHhpreskilhaittgh------ 121 stiff brome
XP_006661609  53 --------hhhhhQPRDsvpnaav------------pteppsINFVRgDMWMHP---QQhhprepkvlhtlav------- 102 malo sina
P0DH88        55 -----phhhhqphHPRDcgangnanggamppppateappsmpMNFARsDMWMHP---QQqqqhhhprehkalhnl----- 121 Japanese rice
Q7XH85        60 -----phhhhqphHPRDcgtnanan------------------------------------------------------- 79  Japanese rice
XP_006347363  66 -------tnGGAFHHHRvcgls---------------espmpMEYMR-DSWVNQkdyREkylnvlsa------------- 109 potato
XP_006374225  53 -------smNAGFYHRDigisq----------------plmpMEYVK-DAWIGQ---REkllnvl--------------- 90  black cottonwood
XP_003528994  49 -------gtDGAFHHRDiggmp---------------qatypIEYMR-DTWISQ---RDkymnmi--------------- 87  soybean
Q9SKD0        51 -------snGS-YHSREq-----------------------dMNY----SWINqpkdnkffn------------------ 77  thale cress
CAN69256      50 -------saNGAFHPRDcmvse----------------apvhMDYVR-DSWINQ---RDkflnil--------------- 87  wine grape
XP_004985071 128 pvgpaghaghpghgghavhhhptgYGMMAD----------AHGVHTLQMMqpqaqqqpqpqpqpqdppP---PKEESMpq 194 foxtail millet
KQJ96172     122 ----------aghvvhtvnpdptgYGIIPG----------TNGLHTLQMMqkaep---------qpppP---PKDECIsp 169 stiff brome
XP_006661609 103 -----------ghgghvphhdpvaYGMIPG----------THAAQTLQMMqqpdpq-------pqqppPppvPKEECIss 154 malo sina
P0DH88       122 --------tvghgsshiahhdpvgYGMIPG-------------THTLQMMqqqtep------qlqpppPpqqPKEECIss 174 Japanese rice
Q7XH85        80 -----------------gngngvgYGMMPA-------------THTLRMLqhqpepq----pqlqhppSpphPKEECIsp 125 Japanese rice
XP_006347363 110 -----------------nhpylpgYGFLPE----------TSSAQSMQMHq-----------------QpnlVKVETA-- 143 potato
XP_006374225  91 ------------------pgnhdyAAVWPE----------TSSSHHMEMFq-----------------PpysTKDEPL-- 123 black cottonwood
XP_003528994  88 -------------------ptnhnYGGIPE----------TSSAHQIQMIq-----------------ApelPKEE---- 117 soybean
Q9SKD0        78 ---------------mlpistpsySNVLSE----------TSGSNSIQMIh-----------------------QPVLns 109 thale cress
CAN69256      88 -------------------pgnsnFQVLPEaplgkekfyhSTEAHPMQIIq-----------------QpepSKDERV-- 129 wine grape
XP_004985071 195 PLIEDHPVLKNE---PPVKKRQQGR----Q--PKSPKPKKPKk-VAAPQENGapn-----kpaPRPRGPRKTVGMVINGI 259 foxtail millet
KQJ96172     170 PLVEENAGFVTEl--PPPKKKQQRR----Q--PKSPKPKKAKk-AAAPCEDGapk------pvPRRRGPKKHVGMVINGI 234 stiff brome
XP_006661609 155 PMIEENVPIVNEq-pPPPKKRQQGR----Q--PKVARPKKPKk-PAAAREDGapnp----ppaPRRRGPKKAIGMVINGI 222 malo sina
P0DH88       175 PLIEENVPVIDEp--PPPKKRQQGR----Q--PKVPRAKKPKk-SAAPREDGappn----apaPRRRGPRKNIGMVINGI 241 Japanese rice
Q7XH85       126 PLMEENVPVKp----PPPKKRQQGR----Q--PKVLRPKKPKk-PAAPCEDGapps----apaPRRRGPRKNIGMVINGI 190 Japanese rice
XP_006347363 144 PLVEEVC-QERDnigGLAKKREAGQ----SqvLKSPKPKKAKkaTRAPKDEStp-------slPRARAPRKSAEVIINGI 211 potato
XP_006374225 124 ELVEEAGVVEKVn--VPNKKRQRHK----G--PKSPRAKKGMggAQVPKPEGsp-------ptQRARAAKKTAEIMINGI 188 black cottonwood
XP_003528994 118 KPVEEAPVVKKAn--GTRKKRQGPK----V--PKSPKAKKPKrvPRAPKDENap-------avQRARVPKKTTEIVINGI 182 soybean
Q9SKD0       110 SRFEENPIPPPApceEQTGKKRKMRgsiaT--PTVPKAKKMRk----PKEERdvtnnnvqqqqQRVKPVKKSVDLVINGV 183 thale cress
CAN69256     130 GRMEDSDLKKEG---GPLKKRTGGG----A--PKTPKIRKTKkgPSVPKDGTns-------svQRVKPAKKNMDVVINGI 193 wine grape
XP_004985071 260 DLDLSRIPTPVCSCTGTPQQCYRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLAN 339 foxtail millet
KQJ96172     235 DLDLSRIPTPVCTCTGAQQQCYRWGAGGWQSACCTTTISTYPLPMSTKRHGARIAGRKMSHGAFKKVLEKLAGEGYNLNN 314 stiff brome
XP_006661609 223 DLDLSRIPTPVCSCTGSPQQCYRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEGYNLNN 302 malo sina
P0DH88       242 DLDLSRIPTPICSCTGAPQQCYRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEGYNLNN 321 Japanese rice
Q7XH85       191 DLDLSRIPTRICSCTGAPQQRYRWGAGGWQSACCTTTVSTYPLPMSMKPRGARIAGRKMSHGAFKKVLEKLASEGYNLNN 270 Japanese rice
XP_006347363 212 NMDISVIPIPICSCTGAAQQCYRWGCGGWQSACCTTNLSSYPLPMNVKRRGSRIAGRKMSLGAFKKVLEKLASEGYNFSN 291 potato
XP_006374225 189 NMDISVIPIPVCSCTGNPQQCYRWGCGGWQSACCTTCISVYPLPMSTKRRGARIAGRKMSLGAFKKVLEKLAGEGYDFSN 268 black cottonwood
XP_003528994 183 DMDISRIPIPVCSCTGATQQCYKWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEGYNFSN 262 soybean
Q9SKD0       184 SMDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISVYPLPMSTKRRGARISGRKMSQGAFKKVLEKLSTEGYSFGN 263 thale cress
CAN69256     194 DMDISGIPIPVCSCTGNPQQCYRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEGYNFAN 273 wine grape
XP_004985071 340 PIDLKTFWAKHGTNKFVTIR 359 foxtail millet
KQJ96172     315 PIDLKTFWAKHGTNKFVTIR 334 stiff brome
XP_006661609 303 PIDLKTFWAKHGTNKFVTIR 322 malo sina
P0DH88       322 PIDLKTFWAKHGTNKFVTIR 341 Japanese rice
Q7XH85       271 PIDLKTFWAKHGTNKFVTIR 290 Japanese rice
XP_006347363 292 PIDLKPHWARHGTNKFVIIR 311 potato
XP_006374225 269 PIDLRTHWAKHGTNKFVTIR 288 black cottonwood
XP_003528994 263 PIDLRTYWAKHGTNKFVTIR 282 soybean
Q9SKD0       264 AIDLKSHWARHGTNKFVTIR 283 thale cress
CAN69256     274 PIDLRRHWAKHGTNKFVTIR 293 wine grape
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap