Conserved Protein Domain Family
CobT

?
pfam06213: CobT 
Cobalamin biosynthesis protein CobT
This family consists of several bacterial cobalamin biosynthesis (CobT) proteins. CobT is involved in the transformation of precorrin-3 into cobyrinic acid.
Statistics
?
PSSM-Id: 399312
Aligned: 55 rows
Threshold Bit Score: 144.289
Threshold Setting Gi: 5834770
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003620055            18 TARAERFKRATVGAVRAVGGNAATEVMFLNGPvapgVSVVGAQVRLPQPAVGMSDADMTRLRGAADAAALRVRHHNEAVH 97  Komag...
WP_015826633             5 ADQHEIFRSALAVTTAAMVADKNVEVGFSADG----GHASGDRIVLNSPPRKLTAASAALARGEADMLALKKRHHDAKAF 80  Hirsc...
Q0BWH9                   5 TSPQELFKQALAATTKAMSAERDIEVGFGPDV-----GDQGTRLVLRTPPVELAPELAARIRGEADALALRRAHHDADAH 79  Hypho...
QianUST:TMO_0335         7 PQSVEQFKRALTSTVKAMAGTPQLEVAFTFEP----PRLRGDRVNLRAPMRNLPEQQVARIRGEADQISLRVRHHDARIH 82  Tistr...
Q2G5P8                   4 ESPLDRFRSVLTGTARAISHDPEVEVAWTADA----PVQSGSSMRVPMPGRALPAEQVAEARGHADSMALRLRHHNAALH 79  Novos...
WP_013833806             4 ETPADRFKSVLAGASRAIAHEKEIEVNWTADA----PSSTGGTFRVPMPGRNLPRGAAMQARGYADSFALKVRHHDDRLH 79  Novos...
Q2N909                   4 ESPLDSFKRALTGTARALAREPEIEVAWSADS----PSAQGRNFRVPLPGRNLPPEQAAEARGFADSFALKLRHHNLKLH 79  Eryth...
WP_013038764             4 rSPLDAFKDVLSGAARSIARDAEVEVGFTADT----PHMAGKAIKVPTPGRNLPADQVALARGYADANALRLRHHNAKVH 79  Sphin...
PRJNA213647:NX02_25810   4 rSPLDDFKAVLGGAARAIAREPEVELTFTADA----PLQSGRHMKVPMPNRSLPAEQVAEARGFADGFALRLRHHDAALH 79  Sphin...
WP_015457880             4 QTPLEAFRQVLGGTARALSHEPEAEVGYAADA----PQAYGKAIKVPMPARSLPAEQVAEARGFADGAALRLRHHNTALH 79  Sphin...
WP_003620055            98 AAAQPDAGEAREIYDALEQARVESVGARYMSGMAANLQARLAQECAEAGFDDAGGGREMPSAMAFGLLARARMTGQPVPA 177 Komag...
WP_015826633            81 SANMPESEEAVAIYEAAERARIDSIGAKAMDGVASNLDAVLEERCERAEFMRIQERTKISQADAIEFLLRERLTGKPLPS 160 Hirsc...
Q0BWH9                  80 LANRPQGDIPRRVYEAAETARIESLGANAMAGTAGNLEAVLDFRCRSTNFGMGAEDPDAVLAPALEFLLREKLTGRPLPE 159 Hypho...
QianUST:TMO_0335        83 MARQPQGELSRRLYESCEQLRIEALGGRNMTGVRGNLARLQEDQLREQPQRLAVDGSPESLCEAALLLLRERLTGVPTPE 162 Tistr...
Q2G5P8                  80 GRNAPSEALARACYDAVEQVRYEALGSNAYAGMRGNLDAAVSMRMASDPISRAAKPEDVPLPTALALLLREKLTGQVAPA 159 Novos...
WP_013833806            80 QRHAPAEPSARACYDAVETVRYEALGSNRYAGMRDNLDASLEARIASDPISRAESRDQVPLQSALALMLREKLTGQPIPE 159 Novos...
Q2N909                  80 EANAPSDPVARACYDAVEQVRYEALGASGYEGIADNLDAAVELRTASDPIARAQNDGDVPLQSALGLMLREQLTGKPIPE 159 Eryth...
WP_013038764            80 NSAAPADATARAVYDAVEQARVEAIGSRAMEGVRANLNHALDLKLKSDPIRRARSADEVPLSTALALKVRERLTGQAAPK 159 Sphin...
PRJNA213647:NX02_25810  80 ARGAPSEAVARSVFDAIETARVEALGARSMAGVRANLGQALDLKIRTDPITRARARDEVPLSTALQLIVRERLTGEAPPA 159 Sphin...
WP_015457880            80 ARNAPAEAVARAAFDAVEQARVEAIGSRAMEGVRANLAHALDLRLKSDPLVRARSRDEVPLSSALGLLVRERLTGQPVPE 159 Sphin...
WP_003620055           178 SMQMTMQRWQDELPAAVLQALDAMVARQDSQVDFARAARQLLVACDLIeqEIDPQAEDEDGSATAQSDESDASDApeepn 257 Komag...
WP_015826633           161 AAEHVADFWRADLEKRASGSLEALEKAMSDQSKFADAVRRLLTDLDMS--DEISPAEESEDQGEEVEDAEDTDEAed--- 235 Hirsc...
Q0BWH9                 160 SAKRVADVWREKVEANAGKALDALTGQLHDQAEFARTIRSIIRDLT------ASDLPGDEAESEDDAPSEETDEQqnq-- 231 Hypho...
QianUST:TMO_0335       163 IARDLVEHWRPMIESKAGEDLARLPEIMADQKRFSEGVRDLLSDLDIEa-ETEGELDEDREPDEADDQAEAEAQEqpdge 241 Tistr...
Q2G5P8                 160 STQTGMAMVRSWIESKVGNDFEGLALSLDDQRAFQQLALDMLQHLDLT------QSASDQDEDTEEDEGEQQEDEge--- 230 Novos...
WP_013833806           160 IARPGVDMIRDWIEEKAGGDIEALADSIGDQQAFQNLSLDMLQHLELTraEEIEQPPEDSDDLDGDDETEQD-------- 231 Novos...
Q2N909                 160 RARAGVELVREYIESRTGSDFEDLAGSLEDQKAFQSLALDMLRHLELT-------DPTDQPDSADNEDGEDEDGQdeqed 232 Eryth...
WP_013038764           160 DVRAGLAMVDQWIEDKAGADLDALAMAIDDQRAFQKLTSAMLEHLQLI----DADVPPETDDSEPQEEGEEEEQSqed-- 233 Sphin...
PRJNA213647:NX02_25810 160 AAEPGLAMVRQWIEDKGGADLDALGLVADDQGAFARLATRLLEDLELV---EGELTPDDDEGGEDQDGGEDDESDdq--- 233 Sphin...
WP_015457880           160 SARQGLALVRDWIEEKAGHDLDALGLALDDQAAFARLATRLLEDLELV---EGEMTPDDEQEAGEEGEGDDQDEGedg-- 234 Sphin...
WP_003620055           258 pqEQDSPAEEEAPGLQMQMSQGTGMGEDeQDNGEQNGAASGSEEA 302 Komagataeibacter hansenii
WP_015826633           236 -qTENSGDEQSESQGSEEFDEEEGESDT---ESESAMAMEAEADM 276 Hirschia baltica
Q0BWH9                 232 sgDDDTQTEEQMGASAEQLEAGETEDLE-GEEANVSVDQDADLDA 275 Hyphomonas neptunium ATCC 15444
QianUST:TMO_0335       242 ggEQSQDGDDSGQSSEGAPETGDGEADA----------DMAASDP 276 Tistrella mobilis KA081020-065
Q2G5P8                 231 -eEPSTSDDQEQQPSEVAGDTSEGDEDSeSEQEVEQNDDAADADM 274 Novosphingobium aromaticivorans DSM 12444
WP_013833806           232 --EDGADAGEEQQPSEMAAEPSQGDDEGeSESEGEASDDMQEAEE 274 Novosphingobium sp. PP1Y
Q2N909                 233 esDDETGGDEQPSPAEMAGEQTEGDAEG--EAETEAGEEVADGEL 275 Erythrobacter litoralis HTCC2594
WP_013038764           234 gdSGEDQAGDSDALAEARAEDQGGDTED-GETEYSDEFDADSEEg 277 Sphingobium japonicum
PRJNA213647:NX02_25810 234 tdDADENEGGAEGDVEMRAEPQDGEQQD-GESDSQQDDAEGDSDA 277 Sphingomonas sanxanigenens DSM 19645 = NX02
WP_015457880           235 edQQDDGSGQSDAPMEARAEASEDAEDD-GESVDMDEDSLSEMES 278 Sphingomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap