6GML


Conserved Protein Domain Family
COBRA1

?
pfam06209: COBRA1 
Click on image for an interactive view with Cn3D
Cofactor of BRCA1 (COBRA1)
This family consists of several cofactor of BRCA1 (COBRA1) like proteins. It is thought that COBRA1 along with BRCA1 is involved in chromatin unfolding. COBRA1 is recruited to the chromosome site by the first BRCT repeat of BRCA1, and is itself sufficient to induce chromatin unfolding. BRCA1 mutations that enhance chromatin unfolding also increase its affinity for, and recruitment of, COBRA1. It is thought that that reorganisation of higher levels of chromatin structure is an important regulated step in BRCA1-mediated nuclear functions.
Statistics
?
PSSM-Id: 399309
Aligned: 14 rows
Threshold Bit Score: 667.536
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6GML_V       104 PSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTElSVLHN 183 human
EKC25449     105 KSLRPVVMAILKHLPQIKDEYLEKILDDKELYAEAATEVKRQIWSDNQALFGDEVSPLLSQYIKEKENSLFSHE-NSAQT 183 Pacific oyster
EDO30397      98 KELRPVVVAVMKHLPKINDECLEHIANDAKLYEDCPIEVKRQIWSKHHHLFGDAVGPLLNQYIEAKYTLLHSTEaHNSHS 177 starlet sea ane...
XP_015794791 105 QTLQPIVMSLLKNLERIDDKYLKQIVADRELYEKCDLSVKRQIWQQHQGLFGDEVSPLFSAYIKEKDTMLFSLQ---SGS 181 two-spotted spi...
Q16FI1       113 KALRPVVMCILRNTSHIDDKYLRILVRDRELYQDTDTEVKRQIWRDNQSLFGDEVSPLLSQYIREKEHILFDHM-NLNNL 191 yellow fever mo...
XP_004933406 113 KALRPVIMGILKNIPHIDDKYLRVLVRDRELYNDTDTEVKRQIWQDNQSLFGDEVSPLLSQYIREKEDVLFDHE-NLTNL 191 domestic silkworm
XP_002424304 102 KQLRPVVMCILRNTPHIDDKYLNILVRDRELYSDTDTEVKRQIWRDNQSLFGDEVSPLLSQYIQDKENILFDHL-NLNNL 180 human body louse
XP_002609285 123 PTLRPVVMHVMKHINNIPEDYLKKLLEDPNLYKESATEVKRQIWRNNQSLFGDEVSPLLSQYIKEKDTLLFSLEpANSNN 202 Florida lancelet
XP_002130034 104 DSLVPVSMCLLKHLPKVPEKYISVLTKDKSLYSACPIQVKRQIWQKNQTIFGDEVLPLLTRYIKEKEVVLLDGEcLEGNN 183 vase tunicate
XP_003455080 106 PSIQPVVMQVLKHLPKVPEKKLKMVMADKELYKVCAVEVKRQIWQDNQALFGDEVSPLLKQYIVEKEAALFSSDlSILHN 185 Nile tilapia
6GML_V       184 FFSPSPKTRRQGEVVQRLTRMVGKNVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSLHDLDVGEICTVDPCHKFTWCL 263 human
EKC25449     184 FYLASPKLRRQSEVVQRLADMVGKNVKLYDMVLQFLRTLFLRTRNMHYCTLRAELLMALHDQEVNDICSIDPCHKFTWCV 263 Pacific oyster
EDO30397     178 FFSVPSKTRRQHAIVQGLAKMIGKSLSLYNLVLQFLRTLFLRANEVHYCTLRSELLMAVHDLEVKDIKDVDPCHKFTWCL 257 starlet sea ane...
XP_015794791 182 FFAMTPKQRRQSEIIQNLVKIIGRNVLLYDTCLQFLRTLFLSTKNSHYCTLRVDLLMALHDADIQDITSMDPCHKFAWCL 261 two-spotted spi...
Q16FI1       192 FFTPTPKVRRQGEVVQKLAHMIGNSVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMALHDLEVQDIISVDPCHKFTWCL 271 yellow fever mo...
XP_004933406 192 FFSPSPKVRRQGAVVQKLAHMIGTSVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMALHDLEVQDIISVDPCHKFTWCL 271 domestic silkworm
XP_002424304 181 FFSSSPKIRRQSEVVQKLAHMIGTSVKLYDMVLQFLRTLFLRTSNVHYCTLRAELLMALHDLEIQDIISVDPCHKFTWCL 260 human body louse
XP_002609285 203 FFTPAPKSRRQGEVVQKLMHMIGRDVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMALHDTEVHEICSVDPCHKFTWCL 282 Florida lancelet
XP_002130034 184 FFTSSPKSRRQGHVVKTLTEMIGKNIRLYDMVLQFLRTLFLKTHNVHYCSLRSEMLMSLHDLEVTEVCTVDPCYKFTWCL 263 vase tunicate
XP_003455080 186 FFSPSPKTRRQGEVVLKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSLHDLDISEICSVDPCHKFTWCL 265 Nile tilapia
6GML_V       264 DACIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAINTLALSTVRHLQELVGQETLPRDSPDLLLLLRLLA 343 human
EKC25449     264 DACIRDKFIDSKRSRELQGFLDGIRRGQEFVLGDLSMVLCDPFSMNTVGLSMMRNLQHCLNNESLPRDSSEIVLLVRMMG 343 Pacific oyster
EDO30397     258 DACIREKSIEGKRVRELQGFLEMAKNGEERVLGDIAMILCDPFAINTIAKSIIKLLHRLANTDTLPRTSEDITFLLRLLN 337 starlet sea ane...
XP_015794791 262 DACIREQNIDPKRSRELQGFLEGVKRGQEQVIGDLSMTLCDPYAVNFLANKAIKIANNLINNENLARENLVLMLILRMLN 341 two-spotted spi...
Q16FI1       272 DACIREKNVDIKRSRELQGFLDNIKRGQEQVLGDLSMTLCDPYAINFLATSAIKILQHLINNEGLPRDNTILILLLRMLA 351 yellow fever mo...
XP_004933406 272 DACIRERNVDIKRSRELQGFLDSIKKGQEQVLGDLSMTLCDPYAINFLATSAIKILQHLINTEGLPRDSTVLILLLRMLA 351 domestic silkworm
XP_002424304 261 DACIREKSVDIKRSRELQGFLDSIKRGQEQVLGDLSMTLCDPYAINFLAQSAIKILQHLIHNEALPRDNTVLILLLRMLA 340 human body louse
XP_002609285 283 DACIRERFIDAKRARELQGFLDGVKRGQEQVLGDLSMILCDPYAVNTVASSSLKVLQHLVAQESLPRDSPELSLLLRMLS 362 Florida lancelet
XP_002130034 264 DACIREHYVDVKRARELQGFLDNVRKGHEQVLGDLSMILCDPFAVNTMLWSVMKIIHELTVKETLPRESTELMLLIRMLK 343 vase tunicate
XP_003455080 266 DACIREKFVDGKRARELQGFLDGVKKGQEQVLGDLSMILCDPFACNTLVLSIMRNLQELLSQDALPRDSPDLMLLLRMLS 345 Nile tilapia
6GML_V       344 LGQGAWDMIDSQVFKEPKMEVELITRFLPMLMSFLVDDYTFNVDQKL--------------PAEEKAPvs----yPNTLP 405 human
EKC25449     344 LGLGSWDMIDSQLFREPKLESSLFTKFLPMISSLMVEDHTRVLSAKL--------------PEEPPLS-------ATPPS 402 Pacific oyster
EDO30397     338 LGVSAWDMIEKQAFKEIPVNDELASKFLPFIMSLMVDSSLNTLNGKV--------------PEDDIEEglv--sdGRHLA 401 starlet sea ane...
XP_015794791 342 LGLHSWDILNSQVYREPKLDVELVTRFLPVLMSLIVDDQVRAVNSKL--------------PPDDRESaltiiehSGPPP 407 two-spotted spi...
Q16FI1       352 LGLSAWIMIDSQDFKEPKLDSQVVTKFLPALMSLMVDDQVRNLHAKL--------------PPDERESaittiehSGPAP 417 yellow fever mo...
XP_004933406 352 LGLSAWVMIDSQEFKEPKLDSQCVTKYLPALMSLMVDDQVRALHNKL--------------PPDERESaittiehSGPPP 417 domestic silkworm
XP_002424304 341 LGLSAWYMIDTQEFKEPKLDCQVVTKFMPALMSLMVDDQVRTLNSKL--------------PPDERESaitiiehSGPAP 406 human body louse
XP_002609285 363 LGLGAWEMIDSQVFKEPKPDNEVITKFLPALMGLMVEDQVRLVAKKL--------------SENHKNS---------TIP 419 Florida lancelet
XP_002130034 344 LGQSAWDIINKQIFKEPKVDVDISNKFIPCMVCIGVCEQSVLLRNKVknlrksvadcdvttPDDDQSKkkskpkkAADIG 423 vase tunicate
XP_003455080 346 LGQGAWDMIDSQVFKEPRLDLEVVTRFLPAMMSVVVDDHTFTVEQKL--------------PSEEKSSls----yPTTLP 407 Nile tilapia
6GML_V       406 ES-------------FTKFLQEQRMACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDLAFGDIFLHLLTGNLALLADE 472 human
EKC25449     403 DL-------------FLTFVKENPIASFTTLYYSLQVTRMKDRVAACNIIPVLVHCENERAYEDTFLHSLISFLIAMSDE 469 Pacific oyster
EDO30397     402 HH-------------FMHMMVSNKVAFKLAWCFMLHLLHQKDKAAVFHALPWYVSPCQAHPLDEIELHILVTALVGMQEE 468 starlet sea ane...
XP_015794791 408 DL-------------YQKFITEDRLATELAIYYTLQVLRQKDRNAVVRVLGFLSNCHDNRISDDRILHSLVSFLIPMADE 474 two-spotted spi...
Q16FI1       418 DA-------------VEAYIQESAVASILAMYYTLHTARQKDRVGILRVMAILASCKDDRAYEDPFLHSLIALMIPMSEE 484 yellow fever mo...
XP_004933406 418 DA-------------CEAYMRESSVCGVIAMYYTLHAAKLRDRGALLRILSILGSCKDGRAYEDPFLHALVALLVQLPDE 484 domestic silkworm
XP_002424304 407 DA-------------CQAYVTESSVASILAMYYTIHTAKLKDKVGLMRVLGILATCDNDRAYEDPFLHLLVSHLIHMSDE 473 human body louse
XP_002609285 420 KT-------------FAKSIRQHGIAAILTLYYLYNVTKHRNKDAIMHIIPKMTDTHNDLSLEDPFVHLLVSLLISMAEE 486 Florida lancelet
XP_002130034 424 DEsndketssttinyIHKHIEKDQLCRIILMWFTLHLVKNKRKTQLIQVLPILGK---ECSMDNVFLHALTTSFTAHPEL 500 vase tunicate
XP_003455080 408 ES-------------FNRYLQENRVACEMGLYYVLHIAKLRNKNALQRLLPALVETYNDMAFGDIFLHLLTGHLTLLSDE 474 Nile tilapia
6GML_V       473 FALEDFCSSLFDGFFLTASPRkENVHRHALRLLIHLHPRVAPSKLEALQKALEPT-GQSGEAVKELYSQLGEKLEQldhR 551 human
EKC25449     470 FAHDDFCSVVFDDYLLPGISR-ENVFRHLLRLLWYIHPKVPQGRLQAILDGTQPN-NEHSECVHTIYQQLTDKINA---W 544 Pacific oyster
EDO30397     469 FNQSEFCDLIFDNFLL-GLTSqTFAVRHTLRLLWYVYPKMDSHKVIHILTSTQPT-SEHPDTIHELHALLVDRIAN---S 543 starlet sea ane...
XP_015794791 475 FSLEDFCTAVFDEIFLSNLDQ-LNVPYHLIKLMHHVYNHLPAHRLDLLIKTLTAC-PIENEKAKEMLTDLVKKVED---F 549 two-spotted spi...
Q16FI1       485 FANEDFCTGLFDEFLFAGLTR-DNVTRHMLKLLWYIHQKLPQGRLQTLLKALQPN-AQHHENVHKLYENLQKRVMA---T 559 yellow fever mo...
XP_004933406 485 FQGEDFSTVLFDEFFFAGLSK-DNVTRHLLKLLWYIHPKLPETRIQTLMKALQPG-TQHNESVHKLYETLQQKLNA---- 558 domestic silkworm
XP_002424304 474 FAAEDFCTVIFDEFFLAGLAR-ESVTRHLLKLMWYIHSKLPPNRLHTLIKVLEPT-SQHIESVHQLYHDLQQKIAR---- 547 human body louse
XP_002609285 487 FSSEDFCSAVFDNFFLVVASR-EGVRRHLLRLLWFLHPKLPTSRLAKLQTQLEPT-KEHSEAVHKQFSALADKINS---Y 561 Florida lancelet
XP_002130034 501 VADDNLCQALFNKLLVVTKSLkETQHRQILRLVINVCHKLPAERLKILITKLEPKgKKAAEVLIQLHQKLKTKVSS---L 577 vase tunicate
XP_003455080 475 FGSEEFCSVVFDGFLLTSFSSkENVHRHTLRMLLHLHHKMSPSYMETLMKTLEPP-KQCSEPLKELYNQLTEKMEA---Q 550 Nile tilapia
6GML_V       552 KPSPa-qAAETPALELPLPSVPAPA 575 human
EKC25449     545 QPSP---ATPQEQLDSPLMSVPTPA 566 Pacific oyster
EDO30397     544 NPSTpgsSQDQPSSVSSLGSSSHSP 568 starlet sea anemone
XP_015794791 550 KAEAdkkAEEPPQEDIALplpvv-- 572 two-spotted spider mite
Q16FI1       560 HHEPmpePMETD-FDSPLKSVPTPG 583 yellow fever mosquito
XP_004933406 559 QTEPgpsATEMEYLDSPLMSVRTPA 583 domestic silkworm
XP_002424304 548 DEETppvLQNLDYLESPLMSVPTPA 572 human body louse
XP_002609285 562 TPSP---AHDSPALESPLMSVPTPA 583 Florida lancelet
XP_002130034 578 QSSAapsEPADPTSASNIlgvatii 602 vase tunicate
XP_003455080 551 KKSPp-pTDETPSLDLGLHPVTVPT 574 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap