Conserved Protein Domain Family
tify

?
pfam06200: tify 
tify domain
This short possible domain is found in a variety of plant transcription factors that contain GATA domains as well as other motifs. Although previously known as the Zim domain this is now called the tify domain after its most conserved amino acids. TIFY proteins can be further classified into two groups depending on the presence (group I) or absence (group II) of a C2C2-GATA domain. Functional annotation of these proteins is still poor, but several screens revealed a link between TIFY proteins of group II and jasmonic acid-related stress response.
Statistics
?
PSSM-Id: 399304
Aligned: 98 rows
Threshold Bit Score: 38.1251
Threshold Setting Gi: 695020695
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERN01521     133 QEPVSQMTIFYAGAVNVYNDIPEDKVQAIIYLAG 166 Amborella trichopoda
XP_002965453 151 vAKGAPLTLFYNGMVYVFDDVTDDMAQAIMILAG 184 Selaginella moellendorffii
XP_006844502 104 SSGAAPLTIFYNGTVTVFD-LPSDKAEKIMKLAE 136 Amborella trichopoda
XP_020151845  69 PAAPSPMTVFYNGSVAVFD-VSHHKAEAIMQMAr 101 Aegilops tauschii subsp. tauschii
XP_015634258  81 AAAAAPMTLFYNGSVAVFD-VSHDKAEAIMRMAT 113 Japanese rice
EDQ60857     328 STSSRQLTIFYGGQAHVFDDVPPDKADAILTLAG 361 Physcomitrella patens
XP_002974248 265 tSATRQLTIFYGGHAHVFDDVSPEKADAIMQMAG 298 Selaginella moellendorffii
XP_006829635 268 ASASRQMTIFYAGQAHVFDDVHPKKADAIMSLAG 301 Amborella trichopoda
EFH43494     228 ASSTKQMTIFYGGQAHVFDDVHPNKADVIMALAG 261 Arabidopsis lyrata subsp. lyrata
XP_006353654 297 SPAGSQMTIFYGGQAHVFDNVHPNKADVIMSLAG 330 potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap