Conserved Protein Domain Family
DUF999

?
pfam06198: DUF999 
Protein of unknown function (DUF999)
Family of conserved Schizosaccharomyces pombe proteins with unknown function.
Statistics
?
PSSM-Id: 114890
View PSSM: pfam06198
Aligned: 3 rows
Threshold Bit Score: 237.212
Threshold Setting Gi: 74624449
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P0CS86  21 MVEDVCNVDLEQGLDLCKPEKVNKQSQRSRQSRQSLFTNTIKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPDGRIS 100 Schizosaccharomyces p...
Q9HGP8  21 MVEDVCNVDLEQGLDLCKPEKVNKQSQRSRQSRQSLFTNTIKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPNGRIS 100 Schizosaccharomyces p...
Q9HDU1   1 MVRDTRNVDLEWGLELCKPEKVNK---------QNLFTNIIKPQKDKINIKTDKIKFFLDNLFTEFSKFHDSCYPDGRIS 71  Schizosaccharomyces p...
P0CS86 101 TRSNFRWPLLIIWSIIIVFAVDKKFEVQKFLSIW-----INENRFYSEIWVPIAIYVCLLVLMLLSLI 163 Schizosaccharomyces pombe 972h-
Q9HGP8 101 TQDKSRWVLLIIWSIITILTIDKKFKIKESYLEW-----IGENQSHSEIWGPIVIYVGLFILLLSAFN 163 Schizosaccharomyces pombe 972h-
Q9HDU1  72 TRSKLRWPLLIIWCILIVFAIDKNFEVKDFLSIWinesfINENRFYSEIWGPIAIYICLFVLLLLGLI 139 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap