Conserved Protein Domain Family
DUF993

?
pfam06187: DUF993 
Protein of unknown function (DUF993)
This family consists of several hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 399297
Aligned: 42 rows
Threshold Bit Score: 535.625
Threshold Setting Gi: 256560822
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Bfae_29080    7 TLLEE-DGSLRTIALADAPAFARPTAPLRSRVIYAAVHVVPQVHGDNTPGAPADIDWDATLAFRRTMWSRGLGVADAMDT 85  Brachybacter...
jgi:Kfla_0308    25 gpsPAvRGDLVEYRLVGKPVAEGTYTPAVSRLAFAAAHVVADPLGDNAPGAPAAIDWEHTLQFRRHLWSLGLSVAEAMDT 104 Kribbella fl...
jgi:Ndas_2018     4 LLLPAaDGTAAPYTLSGTPVDASPLPPARSRTAYAAAHVVADPLAANAPGAPARLDWEATLAFRHHLWDQGLGVADAMDT 83  Nocardiopsis...
BAK34355          4 VRLPQtDGSLRTVALAEPRSWAEHPQPYTSRVAFAAAHVVADPYGENVPGAPAVVDWDATLAFRRHLFRYGLGVAEAMDT 83  Microlunatus...
jgi:Micau_3039    5 ITLPApGGGTERLTLREPPAWRRPSGPPATRIAYAAAHVVADPYADNSPGRPAGLDWDATLAVRRDLWSWGLGVAEAMDT 84  Micromonospo...
ABS02575         22 rrrpdggveLVEHAVSEPVDWEVPAGPARSRTAFAAAHVVPRAGAENVPGAPADLDWDATLAFRHRLWSLGLGVAEAMDT 101 Kineococcus ...
jgi:Bcav_3366    26 vDLPTaDGGWEHREVRVPGPWTTPDRPLTSRVAFAAAHVVPRAAADNTPGAPADVDWDATLAFRHRIWDHGLGVADAMDT 105 Beutenbergia...
jgi:Arth_2424     4 LILPTgDGGTREYRLKSSPAWAKPSAPITSRHAYAAAHVIPEVTADNTPGAPARLDWDATMAYRHELWSYGLGVADAMDT 83  Arthrobacter...
Q5YW41           10 vLLPV-DGRFEPYALGAPGAWTRPTRPISSRVAFAAAHVIPRSTADNTPGAPAEINWDATLAYRHELWSYGLGVADAMDT 88  Nocardia far...
libg:MSMEI_2575  10 vTLPI-DGELRRVELGAPGPWRRPERPITSRIAYAAAHVVPKSSADNIPGAPADLDWEATLAYRRELWSYGLGVADAMDT 88  Mycolicibact...
jgi:Bfae_29080   86 AQRNMGLDPAATRELISRSAeaaRTALEDpeiaavfpAGAavsdlVVAGVNTDQRAEPE--------LSLDEIVEAYLEQ 157 Brachybacter...
jgi:Kfla_0308   105 AQRGMGLDWPATQELIRRSA---AEAP----------DGR-----IAVGVGTDQLPAGE--------HTLDAVIAAYEEQ 158 Kribbella fl...
jgi:Ndas_2018    84 AQRGMGLDWAATAELIRRSG---AEAASR--------GAA-----LACGVGTDQLDLSQ--------ADLESVITAYGEQ 139 Nocardiopsis...
BAK34355         84 AQRNMGLDWAATQELISRSA---AQALEL--------GAR-----IASGVGTDHLPAGP--------VSLDQVIAGYGEQ 139 Microlunatus...
jgi:Micau_3039   85 AQRGMGLDWAATRELIRRSA---AEAAAC--------GGR-----IVAGAGTDQLIGVP--------GTLDEVVAAYAEQ 140 Micromonospo...
ABS02575        102 AQRGMGLDFAATTELVRRSA---TEAAAV--------GGR-----IAAGVGTDQLGPGP--------HTLDEVRAAYEEQ 157 Kineococcus ...
jgi:Bcav_3366   106 AQRGMGLDWAATGELVRRSS---AEARGR--------GAQ-----IACGAGTDQLDPATyapgvdpaAALDAVVTAYREQ 169 Beutenbergia...
jgi:Arth_2424    84 AQRGMGLDWAATQQLIKRTG---VEAASVvaagaaatAGKsvrdlVSCGAGTDQLDPAAlpt---gaAGIQAVLDAYREQ 157 Arthrobacter...
Q5YW41           89 AQRGMGLDWHATAELIRRSG---REAASA--------GGR-----LACGAGTDQLDLAAlps---gaAGLARIVDAYREQ 149 Nocardia far...
libg:MSMEI_2575  89 AQRGMGLDWPAAAELIRRSG---AEAAAV--------GGR-----LACGAGTDHLVPEDvps---gaAGLAVIIDAYREQ 149 Mycolicibact...
jgi:Bfae_29080  158 LRATEATGAGAVLMASRHLARTARTAADYEEVYRRVLEEATAPVVIHWLGTVFDPQLEGYFGS--TDSAEAARTMLRIIE 235 Brachybacter...
jgi:Kfla_0308   159 LAVAEQAGAQPILMASRALCAAANSPDDYRKVYDRLLAQSSRPVILHWLGAMFDPALDGYWGS--DSLDTAADVVVGLIA 236 Kribbella fl...
jgi:Ndas_2018   140 LDVVQGAGATPILMASRALAAVASGPDDYAKVYADLLGRADQPVILHWLGTAFDPALAGYWGF--ADPAEAIEPVAALIA 217 Nocardiopsis...
BAK34355        140 LEFVEGTGSQVILMASRQLAASARHADDYLRVYDTLLSQVSRPVILHWLGEAFDPSLAGYWGS--SDVEVATDTFVGLLT 217 Microlunatus...
jgi:Micau_3039  141 VAVVQEYGATPVLMASRHLAALATGPEDYLRVYERVLREAGTPVVLHWLGDMFDPALSGYWGS--TDLDEATATFAALVH 218 Micromonospo...
ABS02575        158 LALVEDTGAQPILMASRHLAAAASGPEDYLALCSGLLAQVRRPAVLHWLGEVFDPALAGYWGSrpGDVAAATDTFVDLVR 237 Kineococcus ...
jgi:Bcav_3366   170 VALVQDAGAQVVLMASRALAAAARDPEDYAEVYDAVLEDVEAPAILHWLGPMFDPALEGYWGA--TDVASATNVFVDLVR 247 Beutenbergia...
jgi:Arth_2424   158 IAVVSEAGPKVILMASRALAEVANGPDDYLHVYSTLLREADQPVILHWLGTMFDPALAGYWGS--DDVSTATDTFLSLIR 235 Arthrobacter...
Q5YW41          150 VAVVSEAGAQVILMASRALAQVARSAADYAYVYERVLADVERPVILHWLGTMFDPALHGYWGS--ADIDAATEAFRTLVA 227 Nocardia far...
libg:MSMEI_2575 150 VDVVREAGAQVIVMASRALARVASSPADYLRVYDAVLAHTDQPVILHWLGDMFDPALRGYWGS--GEIDTATATFLELIA 227 Mycolicibact...
jgi:Bfae_29080  236 RDPAKIRGVKMSLLDDAAEIAVRERLPG------GVRMLTGDDFHFSHLIVGDGtvttapGAeqvkgeYSDALLGAFAAT 309 Brachybacter...
jgi:Kfla_0308   237 DHTAKVDGIKVSLLDAAKEVALRNRLPE------QVRLYTGDDFNYPELIRGDG------LR------HSDALLGIFAAI 298 Kribbella fl...
jgi:Ndas_2018   218 EHAAKVDGIKVSLLDASLEVRLRRLLPE------GVRLYTGDDFNYPDLVLGDE------QG------HSDALLGVFAAI 279 Nocardiopsis...
BAK34355        218 SHADRIDGVKVSLLSAEHEIGLRARLPQ------GVRLYTGDDFNYPELIEGDG------TH------HSDALLGAFAAI 279 Microlunatus...
jgi:Micau_3039  219 AHADLVDGVKVSLLDAGREVRLRELLPP------AVKVYTGDDYHYPELIEGDG------KR------FSHALLGAFAAI 280 Micromonospo...
ABS02575        238 ANAEHVDGVKVSLLDAEHEKDLRRRLPP------GVRLYTGDDFNYPELVQGDG------EH------HSDALLGIFAGI 299 Kineococcus ...
jgi:Bcav_3366   248 AHADRIDGVKVSLLDAEHEVALRRRLAAidvqghPVRLYTGDDFNYPELILGDE------LG------HSDALLGIFAAI 315 Beutenbergia...
jgi:Arth_2424   236 EHADKVDGVKVSLLDASHEVALRAALPE------GVRLYTGDDFNYPELIDGDG------TH------HSDALLGIFAAI 297 Arthrobacter...
Q5YW41          228 NNRAKIDGVKVSLLDAAHEVALRRALPD------GVRLYTGDDFNYPELIVGDA------HG------HSDALLGIFAAI 289 Nocardia far...
libg:MSMEI_2575 228 NHVDKVDGVKVSLLDAGHEIALRRALPA------GVRLYTGDDFNYPELIIGDD------QG------HSDALLGIFAAI 289 Mycolicibact...
jgi:Bfae_29080  310 APAASAAVQALDAGDPEEARRILDASEQLGRHVFSAPTYHYKTGVAFLAWLNGHQKAFAMVGGMHSARSLPHLSRTIELA 389 Brachybacter...
jgi:Kfla_0308   299 APAAAAALKALDDGDLGRYEQVFAPTVPLARQIFSAPTYYYKTGIALLAWLNGHQPGFGMVGGLQTGRSLPHLAETFRLA 378 Kribbella fl...
jgi:Ndas_2018   280 APAAARALAALDEGDTARYRALMDPTVPLARHLFTEPTFYYKTGVAFLAWLNGHQKGFHMVGGLHSARDLPHLAQAVRLA 359 Nocardiopsis...
BAK34355        280 APAASAALAALDMGDVATYRAEMEPTLELSRHVFAAPTFYYKTGIAFLAWLSGHQDGFTMVGGLQSARSPVHLARVFELA 359 Microlunatus...
jgi:Micau_3039  281 APAASAALGRLDADDPAGFRAILDPTVPLSRHLFAPPTPYYKTGIAFLSWLNGRQPGFTMVGGLHGGRGVPHLVEAFRLA 360 Micromonospo...
ABS02575        300 APAAAAALVRLDAGDVAGFRSALDPTVPLARHVFGAPTPYYKAGIAFLNFLDGRQPGYAMVGGLHSARSAVHQAETFRLA 379 Kineococcus ...
jgi:Bcav_3366   316 FPAASTALQALDAGSGVRARTILDSTQALGRHVFAAPTYYYKTGIAFWSWLNGFQQGFQLVGGLHAGRSAVHLVELFRLA 395 Beutenbergia...
jgi:Arth_2424   298 YPAASAALQSYDAGDAVKARAILDSTRELGKHIFSAPTFYYKTGIAFMSWLNGKQPGFQMVGGLHSGRSVVHLAKTFELA 377 Arthrobacter...
Q5YW41          290 YPAASTALQELDNGNTARAAEIFSATQDLGRHIFAAPTYYYKTGIAFLSWLNGRQAGFSMVGGLSTGRSVPHLIEVFRLA 369 Nocardia far...
libg:MSMEI_2575 290 YPAASTALQELDAGNQARAGEILESTRALGRHIFTAPTYYYKTGIAFLSWLNGLQPGFTMVGGLASGRSLSHLCELFVLV 369 Mycolicibact...
jgi:Bfae_29080  390 ATTGNLEQPALAAERWHSLLRLA 412 Brachybacterium faecium DSM 4810
jgi:Kfla_0308   379 DQAGVLTRPDLAVDRFRRLLAVH 401 Kribbella flavida DSM 17836
jgi:Ndas_2018   360 DAAGALTDPDLAAARMRALLQVS 382 Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
BAK34355        360 NAVRLLPDPELAAHRLGLVLDAA 382 Microlunatus phosphovorus NM-1
jgi:Micau_3039  361 DAAGLLRDPDLAARRMRAYLDVA 383 Micromonospora aurantiaca ATCC 27029
ABS02575        380 DEAGVLSDPALAARRLRDYLAVH 402 Kineococcus radiotolerans SRS30216 = ATCC BAA-149
jgi:Bcav_3366   396 DDAGLLLDPALAASRMHAFLDVN 418 Beutenbergia cavernae DSM 12333
jgi:Arth_2424   378 DQAGLLKDPALAAFRMSDYLRIN 400 Arthrobacter sp. FB24
Q5YW41          370 DRAGLLSDPQLAAHRMRIYLEVN 392 Nocardia farcinica
libg:MSMEI_2575 370 DRAGLLRDPDVAAHRMRMFLEVH 392 Mycolicibacterium smegmatis MC2 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap