Conserved Protein Domain Family
Urate_ox_N

?
pfam06181: Urate_ox_N 
Urate oxidase N-terminal
Cytochrome c urate oxidase (Uox) PuuD is involved in purine degradation. In contrast with soluble Uox it is a membrane protein with an 8-helix transmembrane N-terminal domain and a C-terminal cytochrome c.
Statistics
?
PSSM-Id: 399292
Aligned: 56 rows
Threshold Bit Score: 359.187
Threshold Setting Gi: 575458568
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EHR72843               3 TYLLDWANLLLRWLHVITAIAWVGSSFYFVWLDNHLVRPkspDLLEKGVDGALWAVHGGGFYNPQKYMLAPRKIHTELHW 82  Burkhol...
WP_015488375           3 AYIFEWLSLFFRWFHVIAGIAWIGASFYFIWLDLSLREPp-eWKKEKGIKGDLWAIHGGGFYEVAKYQLGPQTMPKKLHW 81  Thalass...
tigr:TERTU_2061        3 ALLLDWLSLLLRWLHVITAIAWIGASFYFVWLDNSLETPp-eWKKEKGVSGDLWAFHGGGIYEVAKYSLAPPTMPTTLHW 81  Teredin...
WP_012486232           3 ALILEWLNLAFRWFHVVAGIAWIGASFYFIWLDLSLREPp-aWKAKQGIKGDLWAIHGGGIYEVAKYHLRPQDMPSTLHW 81  Cellvib...
WP_012823716           3 SYMLEWLVLMTKWAHLIVGIAWIGASFYFNWLEGHLERGk--GDLTPGVAGDLWAVHGGGFYHVEKFEVAPAKLPELLHW 80  Halothi...
zhongguo:B5T_03916     3 AHLYEWANLLIRWLHITVGIAWIGASFYFNWLENHLQRE---GHKPPGVAGTLWAIHGGGFYYLQKYQVAPEQLPERLHW 79  Alcaniv...
BAN47654               3 AHLTEWLNLGIRWVHMITGIAWIGASFYFVWLENNLNR----SNPRDGLSGDLWAIHGGGIYHLEKYKLAPPKMPDNLHW 78  Pseudom...
CCO61186               3 PHVTEWLNLVIRWIHMIVGIAWIGASFYFVWLENNLNR----INPKTGLAGDLWAIHGGGIYHLEKYKLAPPEMPEKLHW 78  Vibrio ...
PRJNA234054:Hsw_2658  73 GHLMEWLNIVVRLMHVTFGIAWIGASFYFVFLENALNRT---DNVREELAGNLWAVHGGGFYYLEKYKLAPREIPKALHW 149 Hymenob...
pacbio:K649_06615     38 AHAREWLNLVVRWLHIIYGVAWIGASFYFIFLENALER----QGVRAELSGNIWAIHGGGIYYLEKYKTAPKELPRYLHW 113 Meiothe...
EHR72843              83 FYWESYSTWLSGFALFTVLYLWNAGTFLVDKSVYAWTPAGAVAAALGFLVAFWLVYDAICRA-FGagpEADAKVGALVAV 161 Burkhol...
WP_015488375          82 FKWEAYTTWLTGFSLLAIIYYWGANQYLLDPQKMVLTQVHGIGISLGFLLAGVGIYEVMVRSaLR---HWPRVFGAILFS 158 Thalass...
tigr:TERTU_2061       82 FKWEAYSTWLTGTLLLIAVYYFRAEYYLVGPNNLVASPALAISASVLYLVSGLAVYELLVRWiAP---KNTRLFIALLYS 158 Teredin...
WP_012486232          82 FKWEAYTTWLSGTGLLILLYYLQAQTYLVGHNTWILSPAVAIIASVSFMVIGQLVYECLLRTpLV---KNGWAFAAALLV 158 Cellvib...
WP_012823716          81 FKWEAYFTLITGVALLVLVFYRAPSLYLVDSTVADISPQIALISAVGSIVGMWLIYDALCKTkLV---ENGLAFFALIFG 157 Halothi...
zhongguo:B5T_03916    80 FKWEAYYTWMSGFLLLFVVYYLNAGTNLIDPSVAELSPLAASLIGISVLILSWLVYDGLCRSpLG---RRPALLAAVGFI 156 Alcaniv...
BAN47654              79 FKWEAYFTWLSGVALLTVVFYLNPSLYLIAPG-VDISPAAAVAIGIGSLIAGWFIYDFLCDSpLG---KTPALLGLVLFV 154 Pseudom...
CCO61186              79 FKWEAYFTWITGMLLLGIVYYLNAEIYLIAPG-SGLSSAEAIGIGIGSLVVGWFVYDLLCDSaLG---KTPLLLGIIIFA 154 Vibrio ...
PRJNA234054:Hsw_2658 150 FKYEAYFTWLTGFSLLFVVYYFNAGSMLIDPQVLAISPLAGVAIGVGSFVVAWVLYHGLCRTaLV---RNNVAMALLAVL 226 Hymenob...
pacbio:K649_06615    114 FKWDAYLTWVTGFLLLIIVYYADPRTILLAPG-STLPGWAAIAIAIASLVAAWLVYVGLSSTqLL---YRPALFLLVGGV 189 Meiothe...
EHR72843             162 FVVLAAWGASQLFAGRAAFLLVGAMMATAMSANVFFWIIPGQRTVVAAMMAGQAADPVHGRRGKQRSVHNTYFTLPVLVA 241 Burkhol...
WP_015488375         159 LLVFSAWALDQIFSDRAAYLHIGALIGTIMVGNVKLGIMPAQCELVRAVEAGEVPNAEYAAFAKLRSTHNNYFTLPLIFL 238 Thalass...
tigr:TERTU_2061      159 YVVFSCWLAPQLFSDRAAFIHVGALLATIMAANVFLGIMPAQRGFMRAVDAGKTPDKAPMLAAKTRSIHNNYFTLPVIFC 238 Teredin...
WP_012486232         159 VIGFASWMAHQCFSPRAAYLHVGALMATWMAGNVFWGIIPAQRQFVQAVSENLPPNTDAMAFAKLRSTHNNYLTLPVIFC 238 Cellvib...
WP_012823716         158 LIALYALGAFHVLSAKAAFIHVGAVIGTIMVANVFFVIIPSQKKMVKAMQAGVPPDGDFGHRGFIRSLHNNYFTLPVLFI 237 Halothi...
zhongguo:B5T_03916   157 LLVALAWGLSQIFSGRGAYIHVGAAIGTCMVANVFFVIIPGQRAMVDAMTAGREPDAARGLAGAQRSRHNNYLTLPVLFI 236 Alcaniv...
BAN47654             155 LVVGAAWGFTHVFSGRGSYIHVGALIGTIMVGNVFRIIMPAQRALVKAIEENRTPDPVLPAKGLLRSRHNNYFTLPVLFI 234 Pseudom...
CCO61186             155 LLVATAYGLTLVFSGRGAYIHVGAIIGTIMVGNVFRIIMPAQRNLVSAIEKGEKPDPTLPKKGLLRSRHNNYLTLPVLFI 234 Vibrio ...
PRJNA234054:Hsw_2658 227 LCTGFAWFYCQVFSARAAYIHFGAMLGTLMVGNVFFIIIPAQKAMVQAATEGLPLNPELGKHAGLRSLHNNYFTLPVLFV 306 Hymenob...
pacbio:K649_06615    190 LVALAAYLLGQVFSGRGTFMHIGAMLGTIMAANVFFVIIPSQKKLVRAAQRGEALDPNFVAWVQLRSRHNNYLTLPVLFT 269 Meiothe...
EHR72843             242 MLSNHYGQLYSHPFNWLVLVLLMLAGALIRHFFVARHKTHM-KglpapWPWAAAGVAPLLAAVLWLA 307 Burkholderiales bact...
WP_015488375         239 MISNHYPMTYGHEYPWLVLAAIGGLAAFVRHYFNLKHQDQH-K-----PWILVVGIIGLLLVAAWMT 299 Thalassolituus oleiv...
tigr:TERTU_2061      239 MISNHYAFLYGHPYNWLILIALLTITAYARHFFNLRHRGII-K-----PSILILAIVATLAVAAAMQ 299 Teredinibacter turne...
WP_012486232         239 MISNHYPFVYGHAHAWLALVGIGGCLAWGRHFFNLKHLGNR-K-----PLILWTSGAGLLLIAIVMA 299 Cellvibrio japonicus
WP_012823716         238 MIAAHYPIAFANEHVWLLLIMISLAGILIRHFFNLKNRGRK-N-----FLFLVIPLFLIAFAVWFTA 298 Halothiobacillus nea...
zhongguo:B5T_03916   237 MISNHFPGTYGSHWNWLILATLMATSILIRHYFNIRHLPRPaK-----IALPLAGAAGLVVLIIFTT 298 Alcanivorax dieselol...
BAN47654             235 MISNHFPSTYGSQYNWLILAGIAVIAVLVRHYFNTRHDSNK-Y-----AWTLPAGALGMICLAFVTA 295 Pseudomonas resinovo...
CCO61186             235 MISNHFPSTYGSNWNWLILAGLAAFSILVRHYFNTRHGSQK-F-----AWTLPAAAVGMMTLAFITS 295 Vibrio nigripulchritudo
PRJNA234054:Hsw_2658 307 MVSNHFPSTFSHGYPWVVLAAIALGTAGVKHWLNLREKHQA-T-----GLVLPVAAGLLLAVAFVTA 367 Hymenobacter swuensi...
pacbio:K649_06615    270 MIAHHFPMTYNNGANWLILILLFVAGVAVRHFINVTEKEHH-K-----TLTEGGAMPYLLVLAaall 330 Meiothermus ruber DS...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap