4PR7


Conserved Protein Domain Family
KdgM

?
pfam06178: KdgM 
Click on image for an interactive view with Cn3D
Oligogalacturonate-specific porin protein (KdgM)
This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.
Statistics
?
PSSM-Id: 399289
Aligned: 4 rows
Threshold Bit Score: 275.972
Threshold Setting Gi: 60416332
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4PR7_A   1 VSIDYRHEMQDTAQAGhKDRLLISHRFANGFGLSSevkwaqssADKTPNKPFNEQVSNGTEVV-ASYVYKFNSVFSIEPG 79  Dickeya dadantii
P76773  22 AYVENREAYNLASDQG-EVMLRVGYNFDMGAGIML--------TNTYNFQREDELKHGYNEIEgWYPLFKPTDKLTIQPG 92  Escherichia coli K-12
P0A1U8  23 VYVDVRHEYLDDSKAn-YDRAYISHRFANGVGFAIeaisksggDD--TNKAFNDLETQGNEYT-ISYQFKTGD-VAWQPG 97  Salmonella enterica s...
Q8ZQ33  23 ATLDYRHEYADRTRIn-KDRIAIIEKLPNGIGFYVdasvksggVDGEQDKHLSDLVANAIELG-VSYNYKVTDNFVLQPG 100 Salmonella enterica s...
4PR7_A  80 FSLESGSSNNNYRPYLRGRANVTDDLSVALRYRPYFKRNSGNIGK-DNTMDKGYTLTGNIDYTFLKDYTIGYELE-YKKG 157 Dickeya dadantii
P76773  93 GLINDKSIGSGGAVYLDVNYKFVPWFNLTVRNRYNHNNYSSTDLSgELDNNDTYEIGTYWNFKITDKFSYTFEPHyFMRV 172 Escherichia coli K-12
P0A1U8  98 FVLETGNGYSTYKPYFRATWTLNESWWVGARYRFEYVRRSSDIRDdDTIN----RMDVWAGYKW-NNFDWTIEGI-YKKA 171 Salmonella enterica s...
Q8ZQ33 101 FIFESGPDTSIYKPYLRGQYNFDSGVYMAGRYRYDYARKTANYSDdEKTN----RFDTYIGY-VFDELKLEYNFT-WMDS 174 Salmonella enterica s...
4PR7_A 158 TSGKtiLSDNDDYDITHNVKLSYKWDKNWKPYVEVGNVSGSETTDER-QTRYRVGVQYSF 216 Dickeya dadantii
P76773 173 NDFN--SSNGKDHHWEITNTFRYRINEHWLPYFELRWLDRNVEPYHReQNQIRIGTKYFF 230 Escherichia coli K-12
P0A1U8 172 DKYD--LYDGGKDNYEYNFRTAYIIDQ-WSPFVEVGNVSVNSNSDER-QTRFRVGIGYTF 227 Salmonella enterica subsp. enterica serov...
Q8ZQ33 175 Dq---iKFDNKKTNYEHNVALAWKLNKSFTPYVEVGNVAVRNNTDER-QTRYRVGLQYHF 230 Salmonella enterica subsp. enterica serov...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap