Conserved Protein Domain Family
DUF986

?
pfam06173: DUF986 
Protein of unknown function (DUF986)
This family consists of several bacterial putative membrane proteins of unknown function.
Statistics
?
PSSM-Id: 399287
Aligned: 21 rows
Threshold Bit Score: 142.719
Threshold Setting Gi: 502228538
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65UY8             2 TNTILLICIILFFAYAFYDQFGMDKRKGETKLKVRLKKQAKIDAVIFVILIACLFAYQSKEsllNIDSFTIFLLATAVVL 81  [Mannheimia...
WP_012737894       4 vDHTLIIFIISFLIYAVYNEFILNFIKGKTILKVNLERKNKVDATILIGLTIIFIYNNMIN---LSSPLTIYLLFGLLLL 80  Candidatus ...
Q9CMJ4             4 INVLLCLGIFCFLLYAFYDQFFMDCWKGKTLLKVHLKKQGQKDALIFSLLIGIIIYQTYT----NLSSATLYLLTALILL 79  Pasteurella...
jgi:HSM_0957       2 vNAFLIVGICCFFLYAFYDQFLMDYLKGTTKLKVRLKKRAKIDALIFIVLIAIILYQNSG----QINAITLYFLAISILL 77  Histophilus...
jgi:Asuc_0935      2 INTLLILSIVAYFAYAFFEQFGIDRLKGKTHLKVRLKKRTKLDSLIFIALIGIIIWQSEG----QIEPFTLYLLGFLILL 77  Actinobacil...
USMARC:WQG_19710  16 TNTILFLIIFACLAYAIYDQFLLSRLNGETKLAVSLQRQT-IDGWILFGLILLTATQGLAE---GLSSLTLFLLAVCITL 91  Bibersteini...
ACL33249           2 TNILLILAIGLSLLYILYDQLIMDRRKGETRLSVPLVRQASLDTGILIALIVLIIVQGVQT---GIEPLTVFLLCGCIVL 78  Glaesserell...
CBJ81692           4 nDIILIILILLMFAFAIYDEFIINQLKGKTLLNIKLKRKHRIDALIFIVLISIVIYNNVIV---QGNQLTTYLLLFIILF 80  Xenorhabdus...
CBJ89995          13 nDIILIILIALMLAFAIYDEFIIIRLKGKTRLNIKLKRKQRIDALIFIILIAIIIYNNVSS---HGSQFTTYLLSFSILI 89  Xenorhabdus...
Q7N3L5             4 nDIALTGLIVLMLAFAVYDEFVVNFLKGKTHLQIKLKRKHKIDALIFIILILIVVYNNITV---YGSRLTTYLLLFTILV 80  Photorhabdu...
Q65UY8            82 AVYTAFIRSPMLILKEKGFFYSNLFIEYDKIRQLNL---AEGNIFVVDLTNgKRLLLPIADERDKEKVVTFFGGY 153 [Mannheimia] suc...
WP_012737894      81 IIYIFYIRYPKLIFKKDGFFYCNILINYKNIKKIKL---SEDGILAIHLKK-RSIFIKVVYFEDLKKMVHVFLEk 151 Candidatus Hamil...
Q9CMJ4            80 SVYAAFIRAPMLLLKEKGFFFGNIYFQYADIHQVNL---AENNILVIDMKNgKRLLVHLLTDQDREQVIQFFGGY 151 Pasteurella mult...
jgi:HSM_0957      78 SLYIAFIRFPVLLLKEQGFFFENIYIDYAKIRQINL---LENNTLIIELKNkKHLMISPENLQDIEKIVHFFGGY 149 Histophilus somn...
jgi:Asuc_0935     78 SLYTAFFRTPMLVIKHNGFFFENIFITFDKIHAINL---ANDYKLVFDLKNgKRMIAQLTNRADTDAVVALLGGY 149 Actinobacillus s...
USMARC:WQG_19710  92 ALYAVLFREPRWLFKTQGFYLNALFIDYKKIRAVNQaefKNKPVFVIDLTNgKRLFARLKVQEDAEKIIKFLANv 166 Bibersteinia tre...
ACL33249          79 AVYSAFIRYPRLLLKEQGFFFGNFYFLYSHIAQINL---ADQNILVIDLKNnRRLFIRIKQKEDIERVVNFFGGY 150 Glaesserella par...
CBJ81692          81 TIYLGYIRSPKLIFKNKGFYYANRFLQYEKINAMNL---SEDGILMISFEK-NNIYITVSKLDDLEKIYQFLINN 151 Xenorhabdus bovi...
CBJ89995          90 TLYLGYIRSPKLLFKNHGFYFANRFFSYDNIKAMNL---SEDGILMMDLEP-HKIYISVTKLDDLEKIYHFLMNN 160 Xenorhabdus nema...
Q7N3L5            81 TIYIAYIRSPKLFFKNNGFFYANTFISYSRIKTMNL---SEDGILVIGLEN-KKLYISVSQIDDLERIYKFLIEN 151 Photorhabdus lau...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap