Conserved Protein Domain Family
DUF979

?
pfam06166: DUF979 
Protein of unknown function (DUF979)
This family consists of several putative bacterial membrane proteins. The function of this family is unclear.
Statistics
?
PSSM-Id: 399281
Aligned: 62 rows
Threshold Bit Score: 321.398
Threshold Setting Gi: 501247334
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012988168   5 QYLYYLAGFILLVVAVMSWRDRANPRRLTTGLFWGLYGLIFLIGNwsyqlmaiwisdedqaqK------IVHISVGTLVI 78  Xenorhabdus bov...
Q8XKH0        12 EIFYIIVGLLMLNTAIDTLKDQEHKTRIGTAIFWTILSIIFIAGG-----------------A------IPPVVVGALLL 68  Clostridium per...
WP_022355614  21 EVLYFVIGLVTLYVAFRNLQDKENKKRYGSFIFWFLLGLMFVIGP-----------------W------IPPLYTGILMV 77  Faecalitalea cy...
EOU05776      17 EILYIIMGLVLIYTGIRNINDKTNPHRYGSAFFWTVLGIVIAGGR-----------------W------LPAIVNGLLIF 73  Enterococcus hi...
Q838N9        17 EVLYIFMGIILLYTSFRSFRDKTNQHAYGTSLFWGILGILIGFGR-----------------F------IPPVACGVLIF 73  Enterococcus fa...
WP_022462495  19 NIVWILVGLIAIYAGIKNLLDEENPSRIGTAIFWCSFGIVTALGT-----------------W------LPAKVSGVLVI 75  Lachnospiraceae
CDA61874      18 QVMYILSGLFCMYCGVRAWIVKANKHFLPTGAFWFTLGIVVAFGQ-----------------W------LPPLASGILVA 74  Clostridium sp....
WP_009270651  11 EIFYALCGLVCLDAGWRAFRKNDK-AKYGTALFWVLVGVIFILGK-----------------W------IPSTITGGILV 66  Firmicutes
WP_012290352  14 EIAYILCGIICIMTGIRARLNKEA--KIGTMIFWILLGILFAGGG-----------------FlvrhveSGGIIVGVILL 74  Finegoldia magna
Q73RB5        14 EIVYGLCGLVSIITAVISLKDKKN--PIGTFLFWGILGLLFMFGK-----------------VivlnvpYGGAIIGGLLI 74  Treponema denti...
WP_012988168  79 IIALLAGFGGVRLGNYHQPTTEQKQKSAERLGNRLFLPALLIPVVTIVGVLLfnhipglqqtvfgaDNhSTLVTLFSIAL 158 Xenorhabdus bov...
Q8XKH0        69 VIGVLTASKQVNIGNLKMPNVDFAEMQAKKLKNKIFLPSIVIAVGSLVIAQF-----------------TSLSGTVAIGI 131 Clostridium per...
WP_022355614  78 LMVLSPILKQVGVGSEPAPSNEETEKNYKKIGMKIFIPALSIGVCALAFALV-----------------TPISPLVGMGV 140 Faecalitalea cy...
EOU05776      74 AMTVPAIAKKVSKGESRLPSKQYMEKMSDKLGMKIFIPALSIGIFAILFALF-----------------TKLGALVGVGV 136 Enterococcus hi...
Q838N9        74 VMTIPAILQKVTKGESRLPSKEYMEKMSQKLGMKIFIPALSIGVFAILFATL-----------------TTLGALVGVGV 136 Enterococcus fa...
WP_022462495  76 IMCLPPIFKKVKVGKTNAPEKAHTEAQFKKIGMKIFVPAFCVAVFSLAFSLF-----------------SNMSSMIAITL 138 Lachnospiraceae
CDA61874      75 LTCIPAALNMVKRGNLQSPSKEEQQKNYKKIGMKIFIPAFGAGVFSIIISIFm----------------KGWSSLLGSLF 138 Clostridium sp....
WP_009270651  67 VMGILTVSGQVRIGTFRDVSVEEKEKESRRIKSWIFLPAVTVGLMALVMSFVr-------------IDgAALDGAVMVGI 133 Firmicutes
WP_012290352  75 LLGVLSIANQIKPGEFKELTEEEREKNAEKVGGKIFIPALVMGISAMLLSQLksfki----plknsDAvFSLSAAQVLTI 150 Finegoldia magna
Q73RB5        75 VLGGFTLTKQVKVADIKSATKEEITENSKKVGNKIFIPAVLIGVVAMLLAQMksfkislgtnaagkEIiFGFSTAQVVGL 154 Treponema denti...
WP_012988168 159 GCLAGLIIALRM-TRENI-MQPIQETRRLLDSIGSVFILPQILATLGLLFTAAGVGTVISYLTENYLAVDNRFIAVIAYV 236 Xenorhabdus bov...
Q8XKH0       132 ASVAAVITTFLV-LKAKP-KHLVEDSNRMVQSVGSTSILPQLLAALGTVFTAAGVGDVISSGISNFIPEGNILAGVIAYC 209 Clostridium per...
WP_022355614 141 GVLVAFIMLLAY-SKDNTpSIIMHDCRRMMDIVGPLSMLPTLLAALGSVFTAAGVGDVLSGLVANVIPEGNIVIGMIVYC 219 Faecalitalea cy...
EOU05776     137 GVFAAMVIMMFF-SRDNRpTTFLDDAADMLGTVGPLSMLPMLLASLGAVFTSAGVGTVISNAVGQIVPEGNVNVGIIIYA 215 Enterococcus hi...
Q838N9       137 GVFVAIFIMMFF-SKNNTpKVFFDDAAEMLETVGPLSTLPMLLACLGAVFTSAGVGEIISKGVSAVVPAGNVNVGIIIYA 215 Enterococcus fa...
WP_022462495 139 GVLVAIIFLVAYdSKENKpQVFLKDSERFLSLTGPLSMLPQLLGCLGGVFTAAGVGEVIAQIVEKVVPKGNVNIGIIVYA 218 Lachnospiraceae
CDA61874     139 ATIVGVILLVIW-NRENKaMTFLEEGRRFLDMTSAVYIMPLLLSCLGAIFTKAGVGDAFSNIFGKIIPSGNVYVGIVAYA 217 Clostridium sp....
WP_009270651 134 ACLVSFVLAVII-CRPKV-NETRENTTKQLMQVGASCLLPQLLGALGTLFTEAGVGDVISTMISSVVPSGNILIGVIIYC 211 Firmicutes
WP_012290352 151 SSLLALIIAIII-AKPKA-KETAEDTTKMLMQVGSSSLLPQLLGGLGVIFASAGVGKLIGSLASGIVGDAGVFAAAVAYI 228 Finegoldia magna
Q73RB5       155 ASIVALIFAIFL-TKPKM-KNTINDTSKMLMQVGSSSLLPQLLGVLGAIFATAGIGKIIGHFASGIVPQGVPVLGVIAYC 232 Treponema denti...
WP_012988168 237 LGMAVLTMIMGNAFAAFPIVTAGIGIPILILQhGGNPAVMAAIGMFSGYCGTLMTPMAANFNLVPAALLELPDRNAVIKA 316 Xenorhabdus bov...
Q8XKH0       210 VGMAVFTMIMGNAFAAFSVITVGIGLPFVFAQ-GANVAIAGALALTAGYCGTLLTPMAANFNVMPAALLETKDKNVVMKC 288 Clostridium per...
WP_022355614 220 VGMALFTMIMGNAFAAITVMTVGIGAPFVLAY-GADPVIVGSLALTCGYCGTLCTPMAANFNMVPVAVLEMKDNNGVIKN 298 Faecalitalea cy...
EOU05776     216 LGMVIFTVIMGNAFAAITVMTVGIGAPFVFSH-GANPALVGMVALTCGFCGTLLTPMAANFNVVPVAMLEMKDKYGVIKN 294 Enterococcus hi...
Q838N9       216 VGMVIFTAIMGNAFAAITVMTVGIGVPFVFSL-GADPALVGMVALTCGFCGTLLTPMAANFNIVPVAMLEMKDKYGVIKN 294 Enterococcus fa...
WP_022462495 219 VGMVLFTMIMGNAFAAITVMTVGIGAPFVLAY-GANPVVIGMIALTCGYCGTLMTPMAANFNIVPVAILNMKDRWGVIKN 297 Lachnospiraceae
CDA61874     218 LGMMLFTIIMGNAFAAITVMTVGIGVPFVISL-GANPLYMVTLAMTCGYCGTLLTPMAANFNIVPGVYLEVKDKYSIIKM 296 Clostridium sp....
WP_009270651 212 LGMVIFTMIMGNAFAAFSVITLGIGIPFVIAQ-GGNPVVVGALGMTCGFCGTLLTPMAANFNIVPTAVLETRNKWTVIRA 290 Firmicutes
WP_012290352 229 VGMVIFTMIMGNAFAAFTVITLGIGVPLLMAK-GANPAIVASLGMTAGYCGTLMTPMAANFNIVPAAILEMKDKNGVIKA 307 Finegoldia magna
Q73RB5       233 LGMVIFTMIMGNAFAAFTVITIGVGVPFVIAQ-GGNPAVVGALGMTCGYCGTLLTPMAANFNIVPAAILETKNKYTLIKA 311 Treponema denti...
WP_012988168 317 QIPTGCTLVLTNVFLLYFLMF 337 Xenorhabdus bovienii
Q8XKH0       289 QSLFAIILLVIHIALMYFLAF 309 Clostridium perfringens
WP_022355614 299 QILIAVIMLVIQTVMMIILs- 318 Faecalitalea cylindroides
EOU05776     295 QLFVAIFMLVFQIVYMILfk- 314 Enterococcus hirae ATCC 9790
Q838N9       295 QLPIALFMLIFQIVYMILfk- 314 Enterococcus faecalis
WP_022462495 298 QVLVGLIMLVFQICYMIVLk- 317 Lachnospiraceae
CDA61874     297 QLIPSLLMLVFQIIYMCMMvn 317 Clostridium sp. CAG:169
WP_009270651 291 QAPMAFAMIVVHIVLMLLLAF 311 Firmicutes
WP_012290352 308 QLPVALALIVVHVVLLMILAF 328 Finegoldia magna
Q73RB5       312 QALMSFALIIVHIILMLIFAF 332 Treponema denticola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap