Conserved Protein Domain Family
DUF969

?
pfam06149: DUF969 
Protein of unknown function (DUF969)
Family of uncharacterized bacterial membrane proteins.
Statistics
?
PSSM-Id: 399272
Aligned: 50 rows
Threshold Bit Score: 244.712
Threshold Setting Gi: 548244539
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBJ88842           12 FWPLMGIAVIIIGFIIRFNTVLVVTIAGFVTGLAANMSMIEILEKLGAGFLNTLNLSLTILFpLVIIGLLERHGLKEQAQ 91  Xenorhabdu...
Q74HE7              3 YLKLLGILIIVVGFVLKWDTTAVVVIAAIVTGLFSGMDFVKLLEVIGKSFVENRMVSLFFLT-LPMIGLVESHGLRDYTV 81  Lactobacil...
CDM70131            1 -mSLIGILIIIVGFALKLDTIAVVVSAGIITGLVSGMDITEILTTLGNAFVNNRTTCLFMLT-LPVIGLCERYGLKSKAT 78  Clostridiu...
Q8XKG9              1 -mELIGIVIVIIGFALKFDTIAVVLVAGLSTGLVAHMSLYEILEKLGSTFVSQRHMTLFILT-LPVIGVCERFGLKERAI 78  Clostridiu...
jgi:SpiBuddy_2547   3 lLKLIGVLIVIVGFVLKKDTIATVVIAGVVTGLVAGMPFLEILNTLGKSFISQRTATLFVLT-LPVIGICERYGLKDKAV 81  Sphaerocha...
CDE26949            4 aIKLIGIVIVVIGFVMKFDTLATVVVAGLVTGLISGMSIMDILNTLGTAFLKNRTATLFILT-LPVVGLCERMGLRDKAV 82  Catenibact...
CCY44072            3 iIKLIGVLIVVIGFILKLDTLAVVVVAGLATGLVAGMSPMDILNTLGTAFITNRTATLFILT-LPVIGLCERNGLKDKAV 81  Clostridiu...
Q186N4              1 MIKLIGILIVVIGFILKIDTLFTVLLAGVATGIVAGLDFNQIFTILGDSFVSNRGVSLFILT-LPVIGVLERYGLKQRAV 79  Clostridio...
Q3Y1V2              4 YLSLLGVLIVILGFAFKLDSILIVMVALVVTALTGGLGIQGMLELLGTSFVNNRGMAIFIII-MLATGTLERNGLKESAA 82  Enterococc...
WP_022462494        3 lIKLLGVLIVIVGFALKLDSILIIFLALITTGIVGGLGVGGLLETIGTNFVANRSMAIFMMI-LLVTGTLERNGLREAAA 81  Lachnospir...
CBJ88842           92 KSISHIKTATTGRLLIIYLFIRETSAALGLtSLGGHPQMVRPLLAPMAEGAAENQYG-ELPDSVRHRIRAMSAATDNTGL 170 Xenorhabdu...
Q74HE7             82 NAIKKLKKLTAGKILNIYLLIRELAGVFGI-SLQGQVQFVRPLIAPMVIAAAEDQDKkKLSESEIDLIKGRSAAIDNFGN 160 Lactobacil...
CDM70131           79 MLIENAKKLSTGMLLSGYTLVREITIAMGV-TLGGHPQFVRPLIYPMAEGASIAKYG-NLDKNDIDKIKGFSAASDNIGN 156 Clostridiu...
Q8XKG9             79 TLIKNMKNMSTGKLLSCYLFIREVGAAVSL-RLSGQAQFIRPLINPMAQGAAVSKYG-ELDDKNEDLIKGTAAAMDNYGN 156 Clostridiu...
jgi:SpiBuddy_2547  82 DLIRKTKRATSGRIISLYLAVRALAAAFSL-RLGGHPQFVRPLINPMAQAAYVAKHG-KADEKTEDTIKGYSAAGENFGN 159 Sphaerocha...
CDE26949           83 DLIKGIKNATTGRLLVIWEGVRTVASAFSL-RIGGHPQFIRPLINPMAQAAAIAKYG-DIDEDTEDQIKGMAAATENYGN 160 Catenibact...
CCY44072           82 DFIRSLKNMTTGKLIAIWQVIRTFASAFSL-RIGGHPQFIRPLINPMAQAAAVVQYK-ELDEKSEDQIKGMCAGSENYGN 159 Clostridiu...
Q186N4             80 SLIEKLKRLTTGKVLTIYMIARQIAGALSI-RMSGHPQFVRPLVNPMAQAAGLSNSD-ELKESDEEAIKALSAASENYGN 157 Clostridio...
Q3Y1V2             83 SLIKRFKKVSAGMIVDIYGIFRMIFAAFNV-SFGGVAGFVRPIILPMALGTIESKGL-EVHPKHEEELKGMASAMENVCW 160 Enterococc...
WP_022462494       82 NLIKKVKSATAGKLIAVYGVLNGLFGAFNV-GFGGVAGFIRPVLLPMAEGAIENKEG-TVNEEHLEEVKGLAAAMQNFTW 159 Lachnospir...
CBJ88842          171 FFGEDIFVAFGAIIFMHNFMLE------SgGIQTEPLHIALWGIPTAICAFLIHSVRLYRLDYRLA 230 Xenorhabdus nematophila ...
Q74HE7            161 FFAQNLFVASGGVLLISSTMKS------L-GYKVDPVGIVVNTIPIAIITFVLVFAYNLYFDRQMA 219 Lactobacillus johnsonii
CDM70131          157 FFGQNVFMANPGVLLIVSTLET------L-GIHADALKISQASIVIAVIAFILFVLQNYILDRKFK 215 Clostridium bornimense
Q8XKG9            157 FFGQNVFLASSGVLLIAGTLEE------L-GYGVNALDIAKASVPIAIIALILGVLQNRLLDKRLS 215 Clostridium perfringens
jgi:SpiBuddy_2547 160 FFAQNCFMGASGTLLIVSTLNG------Q-GYEINALQIAMMSIPIAVIAVLVGIGHNYLLDRHLD 218 Sphaerochaeta globosa st...
CDE26949          161 FFAQNCFMGASGTLLIVSTLNElftshgV-NQVVTANQIALWSIPIAVISVFVGGAYALWFDKKLN 225 Catenibacterium sp. CAG:290
CCY44072          160 FFAQNCFMGSSGTLLIVSTLSE------Q-GYPVDALQIAGQSVPIAVISAVVGVIYALIFDQILK 218 Clostridium sp. CAG:7
Q186N4            158 FYGQNLFAGSSGVLLIASTLTQ------F-GYNVTGLNIVKASTIMAVIALVVATIQFTLYDKKLN 216 Clostridioides difficile...
Q3Y1V2            161 FFGQVLFIGGAGALLVQSTLKD------L-GYDVTLGQLALVEVPVAITALVVASVYFYLKEKKLA 219 Enterococcus faecium DO
WP_022462494      160 FFFQVLFVGGAGGILVQTTLAG------L-GYEVSLIDLAAVEIPVALFSLVVSCVYIIVKDNRIS 218 Lachnospiraceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap