Conserved Protein Domain Family
COG2

?
pfam06148: COG2 
COG (conserved oligomeric Golgi) complex component, COG2
The COG complex comprises eight proteins COG1-8. The COG complex plays critical roles in Golgi structure and function. The proposed function of the complex is to mediate the initial physical contact between transport vesicles and their membrane targets. A comparable role in tethering vesicles has been suggested for at least six additional large multisubunit complexes, including the exocyst, a complex that mediates trafficking to the plasma membrane. COG2 structure reveals a six-helix bundle with few conserved surface features but a general resemblance to recently determined crystal structures of four different exocyst subunits. These bundles inCOG2 may act as platforms for interaction with other trafficing proteins including SNAREs (soluble N-ethylmaleimide factor attachment protein receptors) and Rabs.
Statistics
?
PSSM-Id: 399271
Aligned: 16 rows
Threshold Bit Score: 128.54
Threshold Setting Gi: 124466041
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q383M1    46 LCFGEHEFGVvldsdnttehdtegecisaganyvnasddaeqmdfehhnepgetmlaaFEFDPVQFVQNkLSHGVPLDDL 125  Trypanosoma brucei
Q54UC2    53 LCFSKDVFTS------------------------------------------------NTFEVDQFISD-CRKRVNLESV 83   Dictyostelium disc...
Q14746    15 LCFDKDEFMK------------------------------------------------EDFDVDHFVSD-CRKRVQLEEL 45   human
CAP21868  23 LCFNKTHFNR------------------------------------------------DDFNVERFMNL-ARQKADLKTI 53   Caenorhabditis bri...
Q7QFV1    14 LCFDKNEFMK------------------------------------------------KTFSVDEFLHE-NRNAGSLEII 44   Anopheles gambiae ...
Q0C728    17 LCFDKNEFMK------------------------------------------------KTFSVDEFLHE-NRKAGSLEII 47   yellow fever mosquito
Q4Q0F6    80 LCFAEHEFGIivdennptdsrsissssdassl----sssfdsvnghdgpqrrrgqrglPAYDPLSFVKGkVQHGVPLASL 155  Leishmania major
Q4DNE3    72 LCFGEHEFGValdkdvtderdekhdgvg------------sdllrqrnkthqngvviaFDFDPIQFVQEkLDHGVPLRSL 139  Trypanosoma cruzi
Q84LH7    24 PWFKPDSFLR------------------------------------------------PDFDPDAYVAD-LRSYVPLDSL 54   Japanese rice
F4JRR1    31 LWFKPSLFLS------------------------------------------------PNFDSESYISE-LRTFVPFDTL 61   thale cress
Q383M1   126 CRDLETYMSLLNKIILRHVNTDVHDaFVKVSGHLVGMQDDLRLVQHPVAVAVKKVEENIAKLNEMENTVTSQIAEATELE 205  Trypanosoma brucei
Q54UC2    84 QKDLREYSKHLDSELIELINKEYQS-FFSLSTSLVGFDTILNEFSISQSSIKSEIKSFNNEIVKVRGLVEDKLNEKKSIE 162  Dictyostelium disc...
Q14746    46 RDDLELYYKLLKTAMVELINKDYAD-FVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIR 124  human
CAP21868  54 QQDLRLYLKSVQNSMIELINDDYAD-FVHLSSNLVSLQESLNKIELDVNRNWKEFEDSTKESLGMAERIEQKCNELSSNR 132  Caenorhabditis bri...
Q7QFV1    45 RDDLGLYLKVLRSAMIELINQDYAD-FVDLSANLIGLDQQIEAIEGPLQKLRTEVDQVKGALEASMSEIASCLEQKKLLR 123  Anopheles gambiae ...
Q0C728    48 RDDLGVYLKVLRSAMIELINQDYAD-FVDLSANLIGLDRKISGIETPLGKLKDEILAVKEALEGTMRDISDCLEQKKALR 126  yellow fever mosquito
Q4Q0F6   156 SRDLHAYVEYLEDKIAQCVNTDVHTaFVSVSGHLVGMRDELSYMDSPLTTAMEKLSSVVSQLSMTSQKVKGKVKAACDAE 235  Leishmania major
Q4DNE3   140 CRDLEAYATLLDRSILRHVNMDVHDaFVKVSGHLVGMQDELRCVRQSVLAAVKRVEDAMEKLSRLEETVSGQIRDATEVE 219  Trypanosoma cruzi
Q84LH7    55 AAELRSHLASLRAELVGLINRDYAD-FVGLSARLKGVDAAAARMRPPLAELRDKVASFRAAAAAGLAALRSGLEQRAAAT 133  Japanese rice
F4JRR1    62 RSELRSHLASLNRELVDLINRDYAD-FVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFALRNGLQQRSDAA 140  thale cress
Q383M1   206 LMRifdvNFLKVLLLYDHLCVQLEALP 232  Trypanosoma brucei
Q54UC2   163 QKK----KLLQLYISISETLNNMNHLF 185  Dictyostelium discoideum
Q14746   125 KKK----MCVLRLIQVIRSVEKIEKIL 147  human
CAP21868 133 EKQ----AELRDRVAFLCVIEKLSEML 155  Caenorhabditis briggsae
Q7QFV1   124 SYK----KSLQSLARAQASLHKLEDML 146  Anopheles gambiae str. PEST
Q0C728   127 GHK----KSLQSLGKVQGALVKLESLL 149  yellow fever mosquito
Q4Q0F6   236 MERafdaMYLKCMVLYETVAYQLDDLA 262  Leishmania major
Q4DNE3   220 LTRlfdvVFLKILLMFDLLCGRVEALP 246  Trypanosoma cruzi
Q84LH7   134 AAR----ELLELLLDTSHVVSKVEKLI 156  Japanese rice
F4JRR1   141 AAR----EVLELLLDTFHVVSKVEKLI 163  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap