Conserved Protein Domain Family
DUF968

?
pfam06147: DUF968 
Protein of unknown function (DUF968)
Family of uncharacterized prophage proteins found in Gammaproteobacteria. These may be HNH-nucleases, as there are several conserved cysteines and histidines.
Statistics
?
PSSM-Id: 399270
Aligned: 2 rows
Threshold Bit Score: 446.848
Threshold Setting Gi: 81755568
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7ME22 140 EVVGIDSKAATNLIVFRSNVVSVRLHGSVLPLTMPELCWWAVRNKVYHALPHDLLSKIFEEEKTRRRVGGRGYIDTNARY 219 Vibrio vulnificus YJ016
Q7ME22 140 EVVGIDSKAATNLIVFRSNVVSVRLHGSVLPLTMPELCWWAVRNKVYHALPHDLLSKIFEEEKTRRRVGGRGYIDTNARY 219 Vibrio vulnificus YJ016
Q7ME22 220 IQQDSREVLENLAKPVLKLSVDEDPPLLYMRKPKPTTYTSEAYLAFVRKLPCVVNGPGTERDPVVAHHLILHGEGKMGGK 299 Vibrio vulnificus YJ016
Q7ME22 220 IQQDSREVLENLAKPVLKLSVDEDPPLLYMRKPKPTTYTSEAYLAFVRKLPCVVNGPGTERDPVVAHHLILHGEGKMGGK 299 Vibrio vulnificus YJ016
Q7ME22 300 AHDLFTFPLRASEHRKFHNDPAGWEAKHGTQLLHVKNTLRKALDVG 345 Vibrio vulnificus YJ016
Q7ME22 300 AHDLFTFPLRASEHRKFHNDPAGWEAKHGTQLLHVKNTLRKALDVG 345 Vibrio vulnificus YJ016
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap