1XXH


Conserved Protein Domain Family
DNA_pol3_delta

?
pfam06144: DNA_pol3_delta 
Click on image for an interactive view with Cn3D
DNA polymerase III, delta subunit
DNA polymerase III, delta subunit (EC 2.7.7.7) is required for, along with delta' subunit, the assembly of the processivity factor beta(2) onto primed DNA in the DNA polymerase III holoenzyme-catalyzed reaction. The delta subunit is also known as HolA.
Statistics
?
PSSM-Id: 399268
Aligned: 21 rows
Threshold Bit Score: 123.549
Threshold Setting Gi: 81532914
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XXH_A  21 YLLLGNDPLLLQESQDAVRQVAAAQGFEEHHTFSIDPNTDWNA-IFSLCQAXSLFASRQTLLLLLP---------ENGPN 90  Escherichia coli
Q97JK1  20 YIMCGFNEKLMKESINKILKKSISQDFESLNYSVFDGNEVEFEdILNACETVPFMSEKRMVVVYRAgflndnssgSNKNS 99  Clostridium acetobuty...
Q8EHP6  19 YLIFGDDPWLLETSKDQIRQAAKRQGFEERVQLIQETGFNWGD-LTQEWQAMSLFSSRRIIELTLP---------SAKPG 88  Shewanella oneidensis
Q9KTE9  20 YLVFGNEPLLLQEAKTAIEKTAQAQGFLEKHRFSADAGLDWNA-VYDCCQALSLFSSRQLIEIEIP---------ESGVN 89  Vibrio cholerae
Q7MN08  20 YLIFGNEPLLIQESRSAIQKAAFQQGFEERHRFAVDASLDWNQ-VYDCCQALSLFSTRQLIELELP---------ESGVN 89  Vibrio vulnificus YJ016
Q9CLL0  21 YYFVGQDPLLLSENQDRINQYAFKQGFDEKNVITIDQNTNWSD-LFERCQSIGLFFNKQILFLNLP---------EN-LS 89  Pasteurella multocida
P43747  21 YLLQGQDPLLLSETEDTICQVANLQGFDEKNTIQVDSQTDWAQ-LIESCQSIGLFFSKQILSLNLP---------EN-FT 89  Haemophilus influenza...
P57520  21 YIFLGEDFFLLEKNQDMILNFAYKKGFLEKIIIDVEKNQDWKK-IILFYKTNNLFFKKTTLVINFL---------IKKLN 90  Buchnera aphidicola s...
Q98QA4   2 HLIYGQEEFLIESKTKNIIENQKKDSIVFTFYENFEIDD-----LLNDIVQKDLFSPNKIIHIKNWklle--nprPSKVI 74  Mycoplasma pulmonis
Q2FXY5   6 vAIYGDVPELVEKQSAEIISQFLKSDRDDFNFVKYNLYETEIApIVEETLTLPFFSDKKAILVKNAyift--gekAPKDM 83  Staphylococcus aureus...
1XXH_A  91 AAINEQLLTLTGLLHDDLLLIVRGN--KLSKAQEnaaWFTALAN---RSVQVTCQTPEQAQLPRWVAARAKQLNLELDDA 165 Escherichia coli
Q97JK1 100 DKLIKDIEKYVPNVPKHCILVMYYVfdNTREKPSy--RVKKFDK---KVCVVEFSKLRGMQFQKKVKDVFAEKGKQIGKT 174 Clostridium acetobuty...
Q8EHP6  89 ADGSAALQSLLQTPSPDVLLILEGP--KLASEQTnskWFKTLDS---LGIYLPCTTPEGDQFRRWLDSRIAHFKLNLQPD 163 Shewanella oneidensis
Q9KTE9  90 AQTAKELSALVGQLHQDILLLVIGP--KLTKAQEnaaWFKTLAQ---QACWVNCLTPELSRLPQFVQQRCFALGLKPDAE 164 Vibrio cholerae
Q7MN08  90 VSIANELLSVAQILHADIMLVIIGS--KLTKAQEnakWFKTLSQ---QGHWISCLTPDNQRLPQFVLNRCRLLNLKPDQQ 164 Vibrio vulnificus YJ016
Q9CLL0  90 ASLQTRLQELISLLNDDILLILQLP--KLNKATEkqtWFIQANQyepEAVLVHCQTPTIEQLPRWIALRAKSMGLQIEEQ 167 Pasteurella multocida
P43747  90 ALLQKNLQELISVLHKDVLLILQVA--KLAKGIEkqtWFITLNQyepNTILINCQTPTVENLPRWVKNRTKAMGLDADNE 167 Haemophilus influenza...
P57520  91 VILIQNLNKMFSLLHPDILIILKFN--HLSRFIQknkSLKEFK----NYNIVSCFTPYNLNFINWIKYEIQEKKINIEEK 164 Buchnera aphidicola s...
Q98QA4  75 LNKLKLLSEIIEN--DKSLIFIFSHigEIE-KNF---LSDFLLK---KASVKHYKKLELNEKIKFIESYVTKNKIKISTV 145 Mycoplasma pulmonis
Q2FXY5  84 AHNVDQLIEFIEKYDGENLIVFEIYqnKLDERKK---LTKTLKK---HARLKKIEQMSEEEIKKWIQSKLNENFKDIKRD 157 Staphylococcus aureus...
1XXH_A 166 ANQVLCYCYEGNLLALAQALERLSL 190 Escherichia coli
Q97JK1 175 ELNYFCSRVENNMDIVYNEIEKLCC 199 Clostridium acetobutylicum
Q8EHP6 164 ARAMLYSLYEGNLLAADQAMQLLQL 188 Shewanella oneidensis
Q9KTE9 165 AVQMLAQWHEGNLFALAQSLEKLAL 189 Vibrio cholerae
Q7MN08 165 AVQMLAQWHEGNLFALSQSLEKLAL 189 Vibrio vulnificus YJ016
Q9CLL0 168 AIQLLCYSHENNLLALKQSLQLLAL 192 Pasteurella multocida
P43747 168 AIQQLCYSYENNLLALKQALQLLDL 192 Haemophilus influenzae Rd KW20
P57520 165 AFFLLCKYYEGNTLFIYKILDMLFI 189 Buchnera aphidicola str. APS (Acyrthosiphon pisum)
Q98QA4 146 LISYLLINVSSSISIVINEINKLFL 170 Mycoplasma pulmonis
Q2FXY5 158 ALDLFIELTGINFNIVSQEIEKLIL 182 Staphylococcus aureus subsp. aureus NCTC 8325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap