3FZ2


Conserved Protein Domain Family
Phage_tail_U

?
pfam06141: Phage_tail_U 
Click on image for an interactive view with Cn3D
Phage minor tail protein U
Tail fibre component U of bacteriophage.
Statistics
?
PSSM-Id: 399267
Aligned: 6 rows
Threshold Bit Score: 176.53
Threshold Setting Gi: 219691032
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FZ2_D     5 KHTELRAAVLDALEKH-DTGATFFDGRPAVFD-EADFPAVAVYLTGAEYTGEELDSDTWQAELHIEVFLPAQ-VPASELD 81  Escherichia virus L...
Q8ZQ90     3 RHSAVRQAIIAALKKTdDGSTTFFDGRPVVVE-EDELPAVAVYLSDAQYTGPEVDGDIWSAVLHVEVFLKAT-APDSALD 80  Salmonella enterica...
O64326     2 KHRDIRKVIIDALESAiGTDAIYFDGRPAVLE-EGDFPAVAVYLTDAEYTGEELDADTWQAILHIEVFLEAQ-VPDSELD 79  Escherichia virus N15
ACL32255   3 IHTQIRSEVVELLEQQiSDVEHYYNGRPTFIDiDEEQKAIAVFLDEAYCDGITNCDEQWQAQLNIAIYIKSIdNGESELD 82  Glaesserella parasu...
Q8ZQG6     3 KHTQIRHAVLAKLESLsGSSAMLHDGLPVFIE-PEELPALAVWLTDAQFAGQMLDERDWEAVLHVAVFLKAQ-APDAELD 80  Salmonella enterica...
Q8ZN03     3 KHTLIRRAVLEKLESVtGAPVTLFDGLPAFVE-QEDLPAIAVWLTDAQYTGLMTDEDDWQATLHTAVFLRAQ-APDTELD 80  Salmonella enterica...
3FZ2_D    82 AWXESRIYPVXSDIPALSDL--ITSXVASGYDYRRDDDAGLWSSADLTYVITY 132 Escherichia virus Lambda
Q8ZQ90    81 EQMENRVYPALGSVAGLGDI--IRTMSAQGYNYQRDDEMAMWGSADLSYDITY 131 Salmonella enterica subsp. enterica serovar Ty...
O64326    80 DWMETRVYPVLAEVPGLESL--ITTMVQQGYDYQRDDDMALWSSADLKYSITY 130 Escherichia virus N15
ACL32255  83 EIAQ-QIAEVMQTTQSGTGFehIDNLELSQYSYEQDQQQRTWYVANLIFNIEY 134 Glaesserella parasuis SH0165
Q8ZQG6    81 MWMEEKIFPALEEVRGLENL--INTMTPLGYDYQRDSEMATWGMAEITYRITY 131 Salmonella enterica subsp. enterica serovar Ty...
Q8ZN03    81 IWMEEKIFPALEEVSGLERL--IDTMTPLGYDYQRDSEMATWGMAEITYRITY 131 Salmonella enterica subsp. enterica serovar Ty...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap