Conserved Protein Domain Family
BphX

?
pfam06139: BphX 
BphX-like
Family of bacterial proteins located in the phenyl dioxygenase (bph) operon. The function of this family is unknown.
Statistics
?
PSSM-Id: 399265
Aligned: 5 rows
Threshold Bit Score: 168.413
Threshold Setting Gi: 504819483
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCA93868        1 MQSLRIFFIASGIWYLCNLVLLWPPVYAGALPLIYPGIDLGQGQPVFDLLLDAWLIVGIQLAAIGVVALWGARQPWKYI- 79  Novosphingobiu...
jgi:Saro_3893   1 MKVLRTYLIAVGIWYLCNLVLLWPPVYAGALRLIYPGIALGQGTPSFGLLLDAWLIVGIQLAAIGLVALWGARDPLRYW- 79  Novosphingobiu...
WP_015006585    1 MKGLKVWMVGIGIFYILNLVLLWPSLWGPQVPLMYPGVELYQDEVIFQLLLDAWLIVGLGLAAIGVVLIAGARNPMRYYp 80  Cycloclasticus...
jgi:Pnap_4150   1 MRQARTFLLAVGVFYLLNLVGTLPFRALGLFDMMYPGVEMDVGLPMFKLLQDAWFVVGLQLGAIGVVALWGARDPQRYL- 79  Polaromonas na...
P0C1T3          1 MKNARLFLIAIGVFYIINLIGTLPFSTLGLFGRMYPGVELHVGAPIFTLLQDAWAVVGLQLGAIGAVALWGARDPGRYR- 79  Paraburkholder...
CCA93868       80 ALVPVIVLTEAVGAAWDIYSLLCSGEAEWVVFTTLAAHAVIVLGAWYAWTAAHR 133 Novosphingobium sp. PP1Y
jgi:Saro_3893  80 ALVPVIVLTELVGSAWDIYSVVWSGEALWVGLTTLAAHAVIMAGAWFARRAMER 133 Novosphingobium aromaticivorans DSM 12444
WP_015006585   81 ALIPVVFITETIFGIWDIYSAM-NHEDVVVALITLVIHVIIIATGLVVWKNAKA 133 Cycloclasticus sp. P1
jgi:Pnap_4150  80 ALVPLVIATEVVTALWDFYSMAWGRMALGFWLALLVVHAAWIVWGLRVWRAARl 133 Polaromonas naphthalenivorans CJ2
P0C1T3         80 AVIPVVIATEVVDGLWDFYSIVWSHEALWFGLVTLVIHVLWIGWGLHAWRALAS 133 Paraburkholderia xenovorans LB400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap