5US5


Conserved Protein Domain Family
DUF965

?
pfam06135: DUF965 
Bacterial protein of unknown function (DUF965)
This family consists of several hypothetical bacterial proteins. The function of the family is unknown.
Statistics
?
PSSM-Id: 399263
Aligned: 135 rows
Threshold Bit Score: 101.725
Threshold Setting Gi: 361053542
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5US5_A          5 DETVRFD-FDDNRKKAISETLETVYRALEEKGYNPINQIVGYLLSGDPAYIPRYQDARNLIRRHERDEIMEELTKYYL 81 
WP_013174543    6 eGTVSFQ-RPKDGQEAVRAILEAVYNALKEKGYNPINQLVGYMISGDPAYITSYKDARNLICKVERDEILEVLFANYL 82  Syntrophothermus...
Q0AZQ0          6 gETVSFK-LERDDENKVRAILHTVYQALQEKGYNPINQLVGYMISGEPAYITSHSEARNLICKVDRDEIMEVLLKSYL 82  Syntrophomonas w...
Q2RHZ4          6 QETMMFK-VEKEEKVRVRDVLTEVQAALTEKGYDPINQLIGYLLSGDPAYITSHKGARNLIRRVERDEILAELLKSYL 82  Moorella thermoa...
jgi:Acfer_0896  6 QETTMFKpVPESK--SVSETIREVAEALTEKGYNPIDQLAGYLLSGDPAYVTSYKDARLKIRRFERYELIEALLQAYL 81  Acidaminococcus ...
EDS17535        5 tKTKVFS-SEDMRREMIRQNLKTVIDALNERGYNAVHQIAGYLISNDPAYISSHKNARNIIQQIERDEIIEELVKSYL 81  Erysipelatoclost...
WP_006506263    6 tQTRVFN-SEDLKREVIRNNLMTVAEALEERGYNAVHQIAGYLISNDPAYISSHKSARSIIQQADRDEIIEELVKFYL 82  Catenibacterium
WP_003773065    7 tETMAFN-SDEVRRDRIKEILAEVESALEDRGYQSVSQISGYLISNDPAYISSHNNARVKIQEVERYEIIEELVRFYL 83  Erysipelothrix r...
KGJ51824        5 TETMSFK-SDDLKRDNIKHVLRLVKEALDERGYNSVNQLAGYLISNDPAYISSHNNARTIIQSVERYEIIEELVRAYL 81  [Clostridium] in...
WP_013405967    8 DKTMRFK-IQKEDISEAGFVLKKVSKALEEKGYNPISQIVGYLLSGDPAYITSYKDARTMIRTIDRDEIIEELLSSYL 84  Halanaerobium hy...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap