2OEQ,6PRK


Conserved Protein Domain Family
Com_YlbF

?
pfam06133: Com_YlbF 
Click on image for an interactive view with Cn3D
Control of competence regulator ComK, YlbF/YmcA
YlbF Is a family of short Gram-positive and archaeal proteins that includes both YlbF and YmcA which may interact synergistically. The family is necessary for correct biofilm formation, as null mutants of ymcA and ylbF fail to form pellicles at air-liquid interfaces and grow on solid media as smooth, undifferentiated colonies. During development, YmcA, YlbF and YaaT, family PSPI, pfam04468, interact directly with one another forming a stable ternary complex, in vitro. All three proteins are required for competence, sporulation and the formation of biofilms. The YmcA-YlbF-YaaT complex affects the phosphotransfer between Spo0F and Spo0B, thus accelerating the production of Spo0A~P. The three processes of biofilm formation, mature spore formation and competence all require the active, phosphorylated form of Spo0A, as Spo0A-P.
Statistics
?
PSSM-Id: 399261
Aligned: 331 rows
Threshold Bit Score: 29.0417
Threshold Setting Gi: 524721604
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OEQ_D        11 LARQLEQAIRASEPFQQLKRAYEDVRRDETAYRXFANVRDIQLrlhekQxRG---AAILPDEIeQAQKAXALAQQNEKLA 87  Geobacillus ste...
EOU04206      10 EADKLAQLLSEHETIIRYHELERKVQTSSYLEKLTEDIKSAQKeaanyA-YYgkrIAEKEANG-RVEQLTKQFDQHPIVV 87  Enterococcus hi...
BAO05717      10 EVDQLATLLKKNETITRYQELEHKVKHSRYLNQQTEALKQAQKdaaqyA-HYgqkEAEKEAIK-RIEVLTQSIDEYPLVI 87  Enterococcus mu...
CCO11532      16 hLQRLTDLLKENELIQDYQMIEEKAQNHAHLNQLIADIKIKQKeavafN-HYgkpEAEKIAIK-EAEAFTKEFNEHMVVT 93  Carnobacterium ...
Q9CDK8         6 LVDLLVEKIKSLDYVKDFQQAETALMANQELFKAQEEMKALQKeavlyQ-KIdkmQAYKKTSQ-SAQVIEKRIKLHPLVE 83  Lactococcus lac...
WP_003133110   6 skEKLIARILDLDYVKSFQKAENALQEEKELFEQQSKMKELQKeavlyQ-KIgkmQAFKETSN-AAQRIHKSLKNDPLVE 83  Firmicutes
Q8DRW7         7 ALNQLIELLQEHDSVQAFQAVEKKIKALPELKKVAHDMKGYQQdavlfQ-RIeksKAQKEADQ-KAQKMGESLDKLPIVQ 84  Streptococcus m...
Q5M6I2        11 aKEELIDLLKHHEAVLAFQEAEESIGQIPQISDLAGQMKAYQQeavlfQ-KIekqRAYEEAGE-QADLIQHELENLPIVQ 88  Streptococcus t...
CAR43787       7 slaHLIVAIEHHSSVKAYKDSEKRLKDLPQISRSSFEMKKYQQdavlfD-KIgkaRAASETSG-LAKEIENQINEQPIVA 84  Streptococcus u...
CDE28135       8 KADSLNQLILNNPLIQEFKKYEKTLREHPELLSLEDEIKQ-ESqiilkK--KalgELTDEELK-AYQDKKAYFENHPLIV 83  Catenibacterium...
2OEQ_D        88 RLXALEQQXSITIAEVQQIAX 108 Geobacillus stearothermophilus
EOU04206      88 AYRKQLLEANDLLHHLTKMLQ 108 Enterococcus hirae ATCC 9790
BAO05717      88 AYRRQLMEANELLQHLTQMIQ 108 Enterococcus mundtii QU 25
CCO11532      94 SYQDALVEANDILQHLVATVQ 114 Carnobacterium maltaromaticum LMA28
Q9CDK8        84 DYATKLEDVNDLVQYITGELE 104 Lactococcus lactis subsp. lactis
WP_003133110  84 DYLLKMQPVDALLNHVTGEIE 104 Firmicutes
Q8DRW7        85 DYRAKMQDASDLLQYVTKTLE 105 Streptococcus mutans
Q5M6I2        89 DYRQKMQDASDLIQYVTKSIE 109 Streptococcus thermophilus LMG 18311
CAR43787      85 DFREKMQDASDLIQYVTKSIE 105 Streptococcus uberis 0140J
CDE28135      84 NYLNLKSEVNDYLIQVETIIN 104 Catenibacterium sp. CAG:290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap