Conserved Protein Domain Family
NIDO

?
pfam06119: NIDO 
Nidogen-like
This is a nidogen-like domain (NIDO) domain and is an extracellular domain found in nidogen and hypothetical proteins of unknown function.
Statistics
?
PSSM-Id: 399253
Aligned: 110 rows
Threshold Bit Score: 43.0192
Threshold Setting Gi: 1207164480
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002604899  523 VNSFQAILITDGIYSFAKFVYPKngIKWV-------YPDvqwhyyryyaNLRGLPVAGYGAGDsyfynyyyyywsWgy-r 594  Florida lancelet
XP_006006884  171 RNTFQAVLAYDSSSSYTIFLYPEdgLQFYgtrskktYNI----------ELELPARVGFSKGPnys-------lfWkt-e 232  coelacanth
XP_003227637  167 RNTFQAVLAYNALDTYALFLYPDdgIQFYgtrpkesYNV----------HLELPARVGFSRGEy-----------Qrr-e 224  green anole
XP_020957573  178 lNTFQAVLASDESDTYALFLYPAngLQFFgtrpkesYNV----------QLELPARVGFSRGEvd---------dLkr-e 237  pig
XP_012823264  169 RNTFQAVLAYDHSDAYAIFLYPEdgLQFFgtrpkesYNV----------HIELPARVGFSRSEs---------------- 222  tropical claw...
XP_011482732  169 VNTFQAVIAYDETDSYVLFLYPEdgLNFFgtrpkes----------ynveieLPARVGFSRGEvty-------ffFsrse 231  Japanese medaka
XP_003758860  206 NNTFQVVLTFDEFDTYALFLYPTngLQFFatrpkesYDT----------QLELPARVGFSQGKdd---------yQkk-e 265  Tasmanian devil
XP_010710486  170 lNTFQAILAYNEEDTYAIFLYPEggLQFLgtrpkesYNV----------QLELPARVGFSRGDgd---------dGkr-e 229  turkey
ADJ38350      170 RNTFQLVIASTKNASFAIVLYANdgIQFTstt-vegG--------------VAILHAGFSKGIvqg-------flFss-q 226  spotted green...
KAE8602023     95 gNTFQAVLASDESKSYAIFLYPEdgLNFYetq-sknDR-----------NEENSARVGFSKGSerg------ffwTtt-q 155  tropical claw...
XP_002604899  595 EHFYNVPKSGTLNMRSIDEVPGnTGETGVSIYRL 628  Florida lancelet
XP_006006884  233 GPSYQVTSSSEQSVKDLYQNSN-SGRRGVWVFKT 265  coelacanth
XP_003227637  225 GPFYSVT-TSEKSVKNLYQSSN-AGIPGVWVFHI 256  green anole
XP_020957573  238 EQYFSLT-STEQSVKNLYQHSN-LGIPGVWAFHI 269  pig
XP_012823264  223 GPYYSVT-SNEQSVKNLYQTGN-TGVPGIWVFHI 254  tropical clawed frog
XP_011482732  232 GPSYSVT-SDEQSVKNLNRVGN-TGTPGLWLFHT 263  Japanese medaka
XP_003758860  266 GLHFSVT-STEQSVKNLYQISN-LGIPGVWAFHI 297  Tasmanian devil
XP_010710486  230 GHSYNVA-SSQQELQRLERESN-VGMPGVWVFHV 261  turkey
ADJ38350      227 GPYFRITTDEEESIRALAEETN-SGMQGVWVYEI 259  spotted green pufferfish
KAE8602023    156 GPHNEFA-SDYDSLEILCWKTN-SGMQGVWIYEI 187  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap