Conserved Protein Domain Family
Phenol_hyd_sub

?
pfam06099: Phenol_hyd_sub 
Phenol hydroxylase subunit
This family consists of several bacterial phenol hydroxylase subunit proteins which are part of a multicomponent phenol hydroxylase. Some bacteria can utilize phenol or some of its methylated derivatives as their sole source of carbon and energy. The first step in this process is the conversion of phenol into catechol. Catechol is then further metabolized via the meta-cleavage pathway into TCA cycle intermediates.
Statistics
?
PSSM-Id: 399237
Aligned: 14 rows
Threshold Bit Score: 86.1929
Threshold Setting Gi: 123032420
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAI96032               77 QPQSDiLDAKFVRVRNRRENGLVEFDFAIGAPEIFVELLMPTAAFEEFCAVNRVID 132 Sphingobium japonicum UT26S
jgi:Rpic_4631          12 MPVVD-LTRKYVSRIERRTDGLVSFEFAIGWPELSVDLLLPEPAFTAFCERHQVTR 66  Ralstonia pickettii 12J
WP_004265992            5 EPAVD-LNRKFVRLIERRPDGFVEFEFAIGDPELFAEMLLPSDAYDSFCQSNHVVF 59  Thauera
WP_011766174            5 QPAID-ISRKFVRLIEQRADGLVEFEFAIGEPELCAEMLLPVAAFEAFCERNAVVR 59  Azoarcus sp. BH72
jgi:Lcho_3363          19 PVVCD-PSRRYVRLTERRADGLVAFEFSIGWPELAVELLLPEAAFTEFCSTNRVIR 73  Leptothrix cholodnii SP-6
CAS:CtCNB1_3162        33 LPACD-LTRRSVRVLQKRANGFVDFEFSVGWPELTVELAMTEADFEAFCQVQKARl 87  Comamonas thiooxydans
jgi:Rmet_1331          10 EPRFD-PNLRFVSVTAINTQGFVQFEFSVGTPELCVELMLPIAAFEEFCLAQKVTR 64  Cupriavidus metallidurans CH34
calssnu:BYI23_C000570  13 drgFD-ITRRYVRFREHREDGFVEFDFSIGDPRLSVELVMPLREFRTFCHANRVIH 67  Burkholderia sp. YI23
Q0K3T8                  6 VPLFE-ATPRYVRVEGRTPEGFVQFAFSVADPELNVELIMPEPMFEAFCCVNRVRF 60  Cupriavidus necator H16
CAL94462                4 PLSFD-TTRRYVRVTGERPDGFVEFDFAVGEPEIFVEMILPPAAFAEFCHANRVER 58  Azoarcus sp. BH72
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap